KEGG   Paucibacter sp. KCTC 42545: AT984_17365
Entry
AT984_17365       CDS       T04227                                 

Definition
(GenBank) hypothetical protein
  KO
K01423  beta-barrel assembly-enhancing protease [EC:3.4.-.-]
Organism
pkt  Paucibacter sp. KCTC 42545
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pkt01002]
    AT984_17365
Enzymes [BR:pkt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     AT984_17365
Peptidases and inhibitors [BR:pkt01002]
 Metallo peptidases
  Family M48: Ste24 endopeptidase family
   AT984_17365
SSDB
Motif
Pfam: Peptidase_M48 LPD39 DUF4164 TPR_14 TPR_17 TPR_9
Other DBs
NCBI-ProteinID: ALT79970
UniProt: A0A0U2W3H2
LinkDB
Position
complement(4061094..4062725)
AA seq 543 aa
MKQTPRLFSRRGSAPRSVLPRKLALSVLAALLLVSGPRPGVAQVNLPTLGDSVSADLDVG
AERRFGDQIMRQIRPDPDLLDDPILLEYVQGVWAPLVAAGIRLGNIGDETKDHFAWEIFL
VRDKSVNAFALPGGFVGVHLGLIAMTVSRDELASVLGHELSHVTQRHIARRIVGDSRNSL
LATAAMVAGLIIAARSGSVDGANAAIVGSQAAAAAASLAFSRDMEREADRVGFQVMTQAG
YAPAGMFSMFERMEQSYHLMDAGNYPYLRSHPLTSERIGDARTRMGTEAFVRPLGVAEHA
LMAARAKVLMDPRAEAWAALQNLDAGVRDTSSKDGGKGYEQLGARYASALASIKMRDFTR
AENALRSAELTLQLLGPDERASRDLRYLRAELAAAKGQASDGFAALAGLAGERSRPMLMQ
RAQLAMVDSSGTASARQAADDLQTYVSLNPHDPGAWAQLAQLWDRLNQPLRALRAQGEVR
AAMGDLNGAIDRLRSGLRQSRGRDADQIEAAVIDSRLRALTYERRQLLAEMYPRGVPPGA
ELP
NT seq 1632 nt   +upstreamnt  +downstreamnt
ttgaagcaaacacctcgccttttttcgcgccgtggcagcgcgccgcgcagcgtcttgccg
cgcaaattggcgctgagcgtgctggcagccttgttgttggtcagtgggccgcggcccggt
gtagcgcaagtgaatctgccaaccctgggcgattcagtttcggccgatttggatgtgggc
gccgagcggcgtttcggcgaccaaatcatgcgccagatccgccccgacccggacttgctg
gacgaccccatcttgctggagtatgtgcagggcgtttgggcgccgctggtggcggccggg
attcggttgggcaatatcggtgacgagaccaaggatcacttcgcctgggaaatcttcttg
gtgcgcgacaagagcgtcaacgctttcgcgctgccgggcggctttgtgggcgttcacctg
ggcttgattgcgatgacggtgtcgcgcgatgagttggcttccgtgttgggccacgagttg
tcgcatgtgacgcagcggcatatcgcgcgccgcatcgtcggcgactcgcgcaatagcttg
ctggccacggcggcgatggtggccggcctcatcatcgcggcgcgcagcggcagcgtggac
ggcgccaacgcggccatcgtcggcagccaggcggcggcggcagcggcctcgctggctttc
tcgcgcgatatggagcgcgaggccgaccgggtgggctttcaggtgatgacgcaggcgggc
tatgcgccggccggcatgtttagcatgttcgagcgcatggagcagagctatcacctgatg
gacgcgggcaactacccctatctgcgctcgcacccgctgaccagcgagcgcatcggtgac
gcccgcacccgcatgggcaccgaggcctttgtgcgcccgctgggcgtggctgagcatgca
ttgatggcggcgcgggccaaggtcttgatggacccgcgcgcggaagcctgggccgcgcta
cagaaccttgacgccggcgtgcgcgacaccagcagcaaggacggcggcaagggttatgag
caactcggcgcacgctatgccagcgccctggcttccatcaagatgcgtgatttcacgcgt
gccgagaacgccctgcgcagtgccgagctgaccctgcagctcttgggtccagacgagcgc
gccagccgtgatctgcgctatctgcgtgccgagttggctgcggccaagggccaggcgagc
gatggctttgcggcgctggctgggctggcgggtgagcgctcccggcccatgctgatgcag
cgcgcccagctggccatggtggacagcagcggcaccgcatcggcccgccaggcggccgat
gatttgcaaacctatgtgagcctcaatccgcatgaccccggcgcttgggcgcaattggcc
cagctgtgggatcgcttgaaccagcccttgcgtgcgctgcgggcgcaaggcgaggtgcgc
gcggccatgggagatttgaatggcgcgattgaccgtttgcgctcaggtctgcggcagtcg
cgcggccgtgatgccgatcagatcgaggcggcggtgatcgattcgcgcttgcgcgcgctc
acctacgagcgccgccaattgctggccgagatgtacccgcgtggcgtgccgccgggcgct
gaactgccttga

DBGET integrated database retrieval system