KEGG   Paucibacter sp. KCTC 42545: AT984_18695Help
Entry
AT984_18695       CDS       T04227                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pkt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT984_18695
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pkt02000]
    AT984_18695
Enzymes [BR:pkt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT984_18695
Transporters [BR:pkt02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT984_18695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_C_3 GST_C_2 GST_N_3 GST_N_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: ALT78916
UniProt: A0A0U3DRW8
LinkDB All DBs
Position
4376682..4377290
Genome map
AA seq 202 aa AA seqDB search
MKLYYSPGACSLSPHIALREAGLPFELVLASTKTKKLADGSDFYAINSKGSVPVLELDNG
ERLTEGPAIVQYIADQAPAAKLAPANGSWERYRLQEWLNFITSELHKGFSPLFNPATGEE
HKALARTQLASKLAWVNAQLEGKQYLMGDEFSVADAYLFVVSNWGQYVGVEVAGLPNLVA
LRARVAARPAVVEAMKAEGLIK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctattacagccccggcgcctgctccctgtctccccatatcgctctgcgtgaa
gcgggcctgccctttgaattggtgctggccagcaccaagaccaagaagctggccgacggc
agcgacttctatgccatcaactccaagggctcggtgcctgtgctggagttggacaatggc
gagcgcctgaccgaaggcccggccatcgtgcaatacatcgccgatcaggcccccgccgcc
aagctggcgccggccaatggcagctgggagcgctatcgcctgcaggagtggctcaacttc
atcacctccgagctgcacaagggcttttcgcccctgttcaacccggctaccggcgaagag
cacaaggccctggcgcgcacgcagctggccagcaagctggcttgggtgaacgcgcagctg
gaaggcaagcagtacctgatgggcgatgagttcagcgtggccgacgcttatctgttcgtg
gtcagcaactggggccagtatgtcggcgtggaagtcgctggcctgccgaatctggtggcc
ttgcgcgcccgcgtggccgcccgccccgcggtggtcgaggcgatgaaggccgaaggcctg
atcaagtaa

DBGET integrated database retrieval system