KEGG   Paucibacter sp. KCTC 42545: AT984_19285Help
Entry
AT984_19285       CDS       T04227                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pkt  Paucibacter sp. KCTC 42545
Brite
Enzymes [BR:pkt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AT984_19285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ALT80027
UniProt: A0A0U3DD43
LinkDB All DBs
Position
4505164..4505640
Genome map
AA seq 158 aa AA seqDB search
MAAPADLSITVSQVNPAGVLKSLGTVAVTQTAYGLVFTPDLQGLPPGVHGFHIHENGSCD
SAMKDGQPVAGLAAGGHYDPLGSKKHGSPWGDGHLGDLPGLVVDAAGKASYAVLAPRLKL
ADIKGRSLMVHAGGDNHADHPMPLGGGGQRMACGVIAN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgccggccgatctcagcatcaccgtcagccaggtcaacccggcgggcgtgctc
aagtccctgggcacggtggccgtcacccagacggcctatggcctggtcttcacccccgat
ctgcaaggcctgccacccggcgtgcatggcttccacattcacgaaaacggcagctgcgat
tcggccatgaaagatggtcagcccgtcgctggcctggcagcaggtggccactacgacccg
ctgggcagcaagaagcacggcagcccctggggtgacggccatctgggtgacttgcccggc
ctggtggtggatgccgctggcaaagccagttatgccgtgctggcgccgcgcctcaaactg
gccgacatcaagggccgtagcctgatggtgcacgccggaggtgacaaccatgccgaccac
cccatgcctttgggcggcggcgggcagcgcatggcttgcggggtgatcgcgaattga

DBGET integrated database retrieval system