KEGG   Paucibacter sp. KCTC 42545: AT984_20055Help
Entry
AT984_20055       CDS       T04227                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
pkt  Paucibacter sp. KCTC 42545
Pathway
pkt00473  D-Alanine metabolism
pkt01100  Metabolic pathways
pkt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pkt00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    AT984_20055
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    AT984_20055
Enzymes [BR:pkt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     AT984_20055
Peptidoglycan biosynthesis and degradation proteins [BR:pkt01011]
 Precursor biosynthesis
  Racemase
   AT984_20055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ALT79140
UniProt: A0A0U3DSF7
LinkDB All DBs
Position
complement(4688322..4689434)
Genome map
AA seq 370 aa AA seqDB search
MPRPIEAHIHLPAIAHNLARARARAPDAKLWAVVKANAYGHGIAHAYEAMRSADGFALLD
FAEAKLLRELGWRGPILLLEGCFEARDLELCSRLKLWHTVHCEQQIDWLAMHKTHEPHRV
FLKLNSGMNRLGFTPQAFRAAWTRLNVLPQVDEISLMTHFSDADGEIGIEAQVAAFERVC
ADLPGERSLSNSAAILRHSERLRSDWVRAGILTYGGVPDYPVHDQGFWDLQPAMSLRSKI
IAVQHLQPGDTVGYGSSFTATAPMRIGVVACGYADGYPRHCPTGTPVLVDGQRCSTVGRV
SMDMLAVDLTALPKAGAGSEVTLWGRSSKGQVLPIDEVAQAAKTIGYELMCALALRVPVT
VDHGAAGLAG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtcctattgaagcccatatccacctccccgccatcgcccacaacctggcccgc
gcacgcgcccgtgcgcccgacgccaagctctgggccgtcgtcaaggccaatgcctacggc
catggcattgcccatgcttatgaagcgatgcgcagcgccgacggcttcgccctgctggac
tttgccgaggccaaattgctgcgtgaactgggctggcgcggcccgatcttgctgctggaa
ggctgcttcgaggcgcgcgacctggagctgtgctcgcgcctgaagctgtggcacacggtg
cattgcgagcagcagatcgactggctggccatgcataagacgcacgagccgcaccgcgtg
ttcctcaagctcaatagcggcatgaaccgcctgggtttcacaccgcaagccttccgcgcg
gcgtggacgcgcctgaatgtgctgccccaggtggacgaaatttcgctgatgacgcacttc
tccgacgccgacggcgagattggcatcgaggcccaggtggcggctttcgagcgcgtctgc
gccgacctgccgggcgagcgctccttgagcaatagcgccgccatcctgcgccacagcgaa
cgcctgcgcagcgactgggtgcgcgccggcatcttgacttacggcggcgtgcccgactat
ccggtgcacgaccaaggcttctgggatttgcagccggccatgagcttgcgctccaagatc
atcgccgtccagcacctgcagcccggcgacacggtgggctatggctccagcttcaccgcc
acggcgcccatgcgcatcggcgtggtggcctgcggttatgccgacggctacccgcgccac
tgccccaccggcacacccgtgctggtggacggccagcgctgcagcacggtcggccgggta
tcgatggacatgctggcggtggacctgacggcgctgcccaaagccggcgccggcagcgag
gtcacgctgtgggggcgtagcagcaagggtcaggtcttgccgatcgacgaagtggcccag
gccgccaagaccatcggctatgagctgatgtgcgccctggcgctgcgggtgccggtgacg
gttgatcacggcgccgctggcctggcaggctag

DBGET integrated database retrieval system