KEGG   Planococcus kocurii: AUO94_00370Help
Entry
AUO94_00370       CDS       T04200                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
pku  Planococcus kocurii
Pathway
pku00230  Purine metabolism
pku00250  Alanine, aspartate and glutamate metabolism
pku01100  Metabolic pathways
Module
pku_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:pku00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AUO94_00370
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AUO94_00370
Enzymes [BR:pku01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AUO94_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt mCpol
Motif
Other DBs
NCBI-ProteinID: ALS77190
UniProt: A0A0U2QD73
LinkDB All DBs
Position
1783979..1785265
Genome map
AA seq 428 aa AA seqDB search
MTSVVVVGTQWGDEGKGKITDFLSEHAEVIARYQGGNNAGHTIIFGGETYKLHLIPSGIF
YKDKTSVIGNGMVVDPKALVKELKGLHDRGVTTENLRISNRAHVLLPYHIKQDEVEEARR
GANKIGTTGKGIGPAYMDKAARVGIRMADLLDHVVFEEKLRMNLKEKNRLFEKFYETEGF
TVEEIMEEYYAYGQEIAKYVTDTSKVLNDAIDDGRRVLFEGAQGVMLDIDQGTYPYVTSS
NPVAGGVTIGAGVGPTTIQHVIGVCKAYTSRVGDGPFPTELFDEVGQQIREVGKEYGTTT
GRPRRIGWFDSVVVRHARRVSGLTDLTVNSIDVLTGLETVKICTAYRHNGELITEYPANL
RMLAECEPVYEELPGWSEDVTSCKSLDELPDNARHYLERIAQLTGVQISIFSVGPDRNQT
NIVTSVWR
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgacatcagtcgtagtagtaggaacgcaatggggagacgaaggaaaagggaaaatcaca
gattttctatctgaacatgcagaagtaattgcacgttaccaaggcggaaacaacgctgga
cataccattatttttggtggagaaacgtacaaactgcatttgattccttcagggattttc
tataaagataagacatctgtaatcggtaacggtatggtcgtagatccgaaagcacttgtg
aaagagttaaaaggtcttcatgaccgtggcgtaacaacggagaacttgcgtatttctaac
cgcgcacacgttttattgccataccacatcaagcaagatgaagtggaagaagcacgccgc
ggagcaaataaaatcggaacaacgggcaaaggcatcggccctgcttatatggacaaagca
gcacgtgtcggaattcgcatggcggatttattggatcacgttgtgttcgaggaaaaactg
cgcatgaacttaaaagagaaaaatcgtctgtttgagaaattctatgaaacagaaggtttt
actgtagaagaaattatggaagaatattatgcatatggtcaagaaatcgctaaatacgta
acagatacatcaaaagtgttgaacgatgcaatcgacgatggtcgccgtgtattgtttgaa
ggcgctcaaggtgtgatgctcgacatcgaccaaggaacttatccgtatgtgacatcttcg
aaccctgtagcgggtggagtgacaatcggtgcaggcgttggtcccacaacaattcagcat
gttattggagtttgtaaagcttatacttcacgtgtcggagacggcccgttcccaacagaa
ttgtttgacgaagtgggtcaacaaatccgcgaagttggtaaagaatacggaactacgact
ggacgcccacgccgcattggttggtttgatagtgtagttgtccgccatgcaagacgtgtt
agtggtttgacagatctaacagttaactcaatcgatgtattaacaggtcttgaaaccgtg
aaaatttgtacagcttatcgtcataacggagagctaattacagaatatccagcaaacttg
cgtatgcttgctgaatgcgagcctgtttatgaagaacttccaggttggtcggaagacgta
acgagctgcaaatcgttagacgagcttcctgataatgcacgtcattatttggagcgcatt
gcacaattgacaggcgttcaaatttcgattttctctgtcggtcctgaccgtaaccaaaca
aacattgtgacaagtgtttggagataa

DBGET integrated database retrieval system