KEGG   Planococcus kocurii: AUO94_03090Help
Entry
AUO94_03090       CDS       T04200                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
pku  Planococcus kocurii
Pathway
pku00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:pku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AUO94_03090
Enzymes [BR:pku01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AUO94_03090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALS77689
UniProt: A0A0U2N9C7
LinkDB All DBs
Position
2353443..2354924
Genome map
AA seq 493 aa AA seqDB search
MKLTNFVDGKWQQAEHAEFRPVLNPANGEELAQVRMSTAQDVDLAVKAAQVAQKKWAKVP
APRRADYLYEIGRLMKERKEHLAQVLTKEMGKVIEEGRGEVQEGIDMAYYMAGEGRRMFG
ETTPSELADKFAMSIRSPIGVVGLITPWNFPVAIATWKSFPAIVGGNAFIWKPATETPMM
AYEMAKIFEEVGLPEGVANIVFGAGSEVGTALIEHEGVRVISFTGSTETGRKVAEAGGRN
LKKVSLEMGGKNAVIVMEDADLDLAVEGILWSAFGTAGQRCTACSRVIVHADVKQELQKR
LLSKMETLTIGDGTDETIKIGPVINRKAVEKIHSYIEIGQQEGATLLVGGEILTGGIYDR
GNYYAPTLFTDVKPEMRIAQEEIFGPVVSIIEVATFEEAIDVNNGVIYGLSSSIYTADVN
RAFKAQRDLDTGIVYINAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWKSVYVDY
SGKLQRAQIDNEA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgactaattttgtggatggtaagtggcagcaggcagaacatgcggaatttagg
cctgttttgaatcccgcaaatggggaagagctggcgcaagttcgaatgtctacagcacag
gatgttgacttagcagtaaaagcagcacaagtagcacaaaaaaaatgggcaaaagtacca
gcacctagacgtgcggattatttatatgaaattggtcgactgatgaaagagcgaaaagaa
cacctcgctcaagtgttaacgaaagaaatggggaaagtgattgaagaaggtcgtggtgaa
gtacaagaaggaattgacatggcttattatatggcgggagaaggaagacgcatgttcggc
gaaacaactccgtcagaactggccgacaaattcgcaatgagcatccggtcaccaattggt
gtcgtaggattgatcactccgtggaacttccctgtagcaattgccacgtggaaatcattt
cctgcaattgttggaggcaatgcatttatttggaaacctgcaacggaaacgccaatgatg
gcctatgagatggcaaagatttttgaagaagtgggtcttccagaaggtgtcgctaatatt
gtttttggagccggctcagaagtaggcacagcacttatcgaacatgaaggcgtaagggtt
atctcgtttacaggatcaacagaaaccggtcgcaaagtagcagaagcaggagggcgcaac
ttgaaaaaagtatctctcgaaatgggcgggaaaaatgccgtcatcgttatggaagatgct
gatttagatttagccgtagaaggtattctttggagtgcatttggtacagctggtcagcgt
tgcacagcttgtagccgtgtaattgttcatgccgatgtaaagcaagaactgcagaaacgg
ctgctttcgaaaatggaaactttgacaattggagatggtacagacgaaaccatcaaaatc
ggaccggttatcaatcgaaaagcagtcgaaaaaattcattcctatattgaaatcggccag
caagaaggagctaccttactggttggtggagagattttgaccggcggtatttacgataga
gggaactattacgctccgacattgttcacggatgttaaacccgaaatgcgcattgcgcaa
gaagaaatttttggtcctgttgtatcaattatcgaagtggcaactttcgaagaagcaatt
gatgtgaacaatggtgtgatttacgggttgtcgagttcaatttatacagctgatgtaaat
cgtgcatttaaagcgcaacgtgatttagataccgggattgtctacattaatgcgggaacg
accggagcggaaattcacttgccgtttggtggaactaaagggactgggaatggtcaccgt
gattcaggcgttgcggcattggacgtttttacagaatggaagagtgtctatgttgattac
agtgggaagttgcaacgtgcgcaaatcgataacgaagcttga

DBGET integrated database retrieval system