Planococcus kocurii: AUO94_06750 Help Entry AUO94_06750       CDS       T04200                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism pku  Planococcus kocurii Brite KEGG Orthology (KO) [BR:pku00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pku03032]     AUO94_06750    03036 Chromosome and associated proteins [BR:pku03036]     AUO94_06750    03400 DNA repair and recombination proteins [BR:pku03400]     AUO94_06750 DNA replication proteins [BR:pku03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AUO94_06750 Chromosome and associated proteins [BR:pku03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AUO94_06750 DNA repair and recombination proteins [BR:pku03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AUO94_06750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 HU-CCDC81_euk_2 Rpf1_C HU-DNA_bdg Motif Other DBs NCBI-ProteinID:  ALS78376 LinkDB All DBs Position 3144276..3144548 Genome browser AA seq 90 aa AA seqDB search MNKTELVNSVAEAAELSRKDAAKAVDAAFETIQDALTKGEKVQLIGFGNFEVRERAARKG RNPQTGAEIEIAASKVPAFKPGKALKDAVK NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaacagaattagtgaactctgttgctgaagcagctgagctttctcgtaaagac gctgccaaagcagttgacgctgcatttgagacgattcaagacgctttaactaaaggtgaa aaagtacagttgatcggattcggtaactttgaagtacgcgaacgcgcggcccgcaaagga cgtaacccgcaaactggtgctgaaatcgagatcgctgcaagcaaagttcctgcatttaag ccaggtaaagcgcttaaagacgcagtgaagtaa

DBGET integrated database retrieval system