KEGG   Planococcus kocurii: AUO94_09515Help
Entry
AUO94_09515       CDS       T04200                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pku  Planococcus kocurii
Brite
Enzymes [BR:pku01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AUO94_09515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ALS78875
UniProt: A0A0U2ZFT7
LinkDB All DBs
Position
complement(230850..231458)
Genome map
AA seq 202 aa AA seqDB search
MAYELPELPYAYDALEPHIDKETMNIHHTKHHNTYITNVNAALEGHEDLASKTVEELIAD
LDAVPESIRTAVRNNGGGHANHSLFWKLLSPNGGGNPTGSLGEAINSKFGSFDEFKEKFA
AAGKTRFGSGWAWLVLSNGELEVVSTPNQDSPIMDGQTPLLGLDVWEHAYYLKYQNKRPD
YINAFWNVVNWEEVSTRYETAK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcatatgaattaccagaattaccttacgcgtatgacgcacttgaaccacacatcgac
aaagaaacgatgaatattcaccatacgaaacaccacaatacttatatcacaaacgtaaat
gcggctcttgaaggccacgaagatcttgcttcaaaaacggtggaagaactaatcgctgat
ttagatgcagttcctgaatccatccgtacagctgtccgcaacaacggcggtggacacgcg
aaccactcattattttggaagttgttatctccaaacggtggtggcaaccctacaggttcg
ctaggcgaagcgatcaatagcaaatttggtagctttgacgaatttaaagaaaaattcgca
gcagctggtaaaactcgttttggttctggctgggcttggcttgttctttcaaacggagaa
ctagaagtggtttctacaccaaaccaagactctccaataatggacggtcaaacgccattg
cttggacttgatgtttgggagcatgcttattacttgaaataccagaacaaacgcccagat
tatatcaacgcattctggaatgtagtaaactgggaagaagtttcaactcgttacgaaaca
gcaaaataa

DBGET integrated database retrieval system