KEGG   Planococcus kocurii: AUO94_13740Help
Entry
AUO94_13740       CDS       T04200                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
pku  Planococcus kocurii
Pathway
pku00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:pku00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AUO94_13740
Enzymes [BR:pku01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AUO94_13740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase Glyco_hydro_2_C Glyco_hydro_14 DUF4434 Cyc-maltodext_C LBP_M DUF3821 Malt_amylase_C
Motif
Other DBs
NCBI-ProteinID: ALS79622
UniProt: A0A0U2QIQ6
LinkDB All DBs
Position
complement(1101481..1103511)
Genome map
AA seq 676 aa AA seqDB search
MINDKLPKIWHGGDYNPEQWESNEIWDEDVRMFKLAGIDVATLNVFSWALNQPDEDTYNF
DWLDDKINRLYENGIYTCLATSTAAHPAWMAKKYPDVLRVDFYGRKRKFGSRHNSCPNSP
TYRKYSERIAETLAERYKDHPAVLIWHVSNEYGGYCYCDNCQDAFRNWLSDKYGTIEKLN
KAWNTGFWGHTFYDWDEIVAPNMLSEEREDNISDFQGISLDYRRFQSDSLLDCYKLEYQA
IKKHTPHLPVTTNLMGTYPMLDYFKWAKELDVVSWDNYPSIDTPFSYTAMTHDLMRGLKN
GQPFMLMEQTPSQQNWQPYNSLKRPGVMRLWSYQAIGRGADTILYFQLRRSVGACEKYHG
AVIEHVGHENTRVFNEVAQLGKELNQLSDTLLDARVNAKVAIVFDWENRWATELSSGPSV
SLDYVKEVHKYYDALYKLNVQVDMIGVEEDLNQYDVVIAPVLYMVKEGYAAKVEQFVQDG
GTFLTTFFSGIVNETDIVTLGGYPGELRNVLGIWAEEIDALHPDETNQIVMKDSRGSMSG
SYSCNLLFDLIHTEGAQAVAEYGSDFYKGMPVLTVNQFGKGKAWYVASSPDEAFLVDFMK
TVCEEAGVEPLLTVPQGVETTERVKEGQTYLFVLNHNDEEVTIELQDIQYQEVLTDAQIN
GTIVLKEKGVLILAKL
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgataaattgccaaaaatttggcacggtggagactataatccggaacaatgg
gagtcaaacgaaatttgggatgaagacgttcgcatgtttaaacttgcaggaatcgacgtg
gctacattaaacgtcttttcttgggctttaaatcaaccggacgaagacacatataacttt
gattggttggacgacaaaattaaccgtctttacgaaaatggtatttacacatgcctggcg
acaagcacagcagcgcacccagcatggatggcgaaaaagtatccggatgtgttgcgcgtc
gacttttacggcagaaaacgtaagttcggtagccgacacaattcatgtccaaatagtcca
acttatcgcaaatactcggaacgaattgcagaaacactagccgagcgatacaaagatcat
ccggctgtcttgatttggcatgtatcaaacgaatacggtggctactgctattgcgataat
tgccaagatgctttccgcaattggttgagcgataaatacggaacgatagaaaagttgaac
aaagcatggaatacgggattttggggccatacgttttacgactgggacgaaatcgttgca
ccgaatatgctgagtgaagaacgtgaagacaatatctcggatttccaaggcatttcactc
gattatcgccgtttccaatccgatagtttactggactgctacaagctagagtatcaagca
attaagaagcacacacctcatctaccggttactacaaatttaatggggacgtatccaatg
ttggattatttcaaatgggcaaaagaactggacgtggtgtcgtgggataactacccatca
atcgatacgccgtttagctatacggccatgacgcatgacttgatgcgtggattgaaaaat
ggtcagccatttatgctaatggaacaaacgccgagtcagcaaaactggcagccgtataat
tcattgaaacgtccaggcgtgatgcgcctatggagctatcaggcaattggtcgcggtgca
gataccattttatacttccagctgagacgttcggttggtgcttgtgagaaatatcacgga
gcagtcattgagcatgtaggacacgaaaacacgcgggtattcaatgaagtcgcacagctt
ggtaaagagctaaaccaattatcggataccttacttgatgcgcgcgtaaacgccaaagtg
gcgatcgtctttgactgggaaaatcgctgggcaacagaattatcgagtggaccttctgtg
tcgcttgactatgtgaaagaagtgcataaatattacgacgctttatacaagctaaatgtt
caagtagatatgattggtgttgaagaagacttgaaccagtatgatgttgtcattgcgcca
gttctttatatggtgaaagaaggctacgccgcgaaagtagagcaatttgttcaagacggc
ggaacattcttgacgacgttctttagcggcatcgtcaacgaaaccgatattgtgacactc
ggtggctacccaggtgaactacgcaatgttcttggcatttgggctgaagaaatcgatgcg
cttcatccagacgaaaccaaccaaatcgtcatgaaagattctcgtggcagtatgagcggc
agttattcatgcaatttgctgtttgacttgatccacacagaaggagcacaagctgtcgca
gaatacggttctgatttttataaaggcatgcccgtgttgacagttaaccagttcggaaaa
ggaaaagcgtggtacgtagcttcgagtcctgatgaagcgttcctcgtcgactttatgaaa
accgtttgcgaagaagcaggcgttgaaccgttacttactgttccgcaaggtgtggaaaca
acagagcgcgtaaaagaaggacaaacgtacttgttcgtgttgaatcataacgatgaagaa
gtaacgatcgagttacaagacattcagtaccaagaagtgcttactgacgcacaaattaat
ggcactatcgtcttgaaagaaaaaggcgtgctgatcttagcgaagctataa

DBGET integrated database retrieval system