KEGG   Pichia kudriavzevii: C5L36_0B07360
Entry
C5L36_0B07360     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
Organism
pkz  Pichia kudriavzevii
SSDB
Motif
Pfam: Trypan_PARP DUF4106
Other DBs
NCBI-GeneID: 40383249
NCBI-ProteinID: XP_029320961
LinkDB
Position
2:complement(1554586..1555212)
AA seq 208 aa
MLWDAIKMAFSPLLLPHTILIGTVSYPFRLLPTPSSMVLLFESVVVVYQYTAMAAMWGAF
VGCINLVIFYIVGRTLTPKGETVSISPVFCEQDGVQADTYKRDVLPRGEETSKESMSFEL
QQLSRQTSPQPSPQPSRQTSRQPSRQPSRQPSPQPSPQPSRQTSRQPSRQTSRQPSRQTS
RQPSPPSSSLLSANTLSSFTELSTRQKQ
NT seq 627 nt   +upstreamnt  +downstreamnt
atgctctgggacgctatcaagatggctttctcgccactgcttttaccacataccattcta
attggcacagtaagctacccgtttcgtcttcttccaactccttcttctatggttctcttg
ttcgagtcggtggtagttgtctaccaatacacagccatggcagctatgtggggggcattt
gttggatgcatcaatctcgttatcttctacatagttggacgtacactgacgccaaaaggc
gagactgtgtctatttcgccagtgttttgtgaacaagatggtgtccaagcagatacgtac
aagagagacgtgctgcccaggggggaggagaccagtaaagagtcgatgagttttgaacta
caacagttatcacgacaaacatcaccccaaccatcaccccaaccatcacgacaaacatca
cgacaaccatcacgacaaccatcacgacaaccatcaccccaaccatcaccccaaccatca
cgacaaacatcacgacaaccatcacgacaaacatcacgacaaccatcacgacaaacatca
cgacaaccatctcctccctcctcctctttgctttcggcaaacactctctcctccttcact
gaactctctacaaggcaaaaacaatga

DBGET integrated database retrieval system