KEGG   Pichia kudriavzevii: C5L36_0B12780Help
Entry
C5L36_0B12780     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
pkz  Pichia kudriavzevii
Pathway
pkz00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    C5L36_0B12780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pkz01003]
    C5L36_0B12780
Enzymes [BR:pkz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     C5L36_0B12780
Glycosyltransferases [BR:pkz01003]
 Glycan extension
  Yeast mannan chain
   C5L36_0B12780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 40383815
NCBI-ProteinID: XP_029321528
LinkDB All DBs
Position
2:2696983..2698695
Genome map
AA seq 570 aa AA seqDB search
MYLLRRYRSLLPYVFVSVFALGIIFSVYVSKSENDIRKLDGFNADPIENSQPGTPEAVEE
KPNDDADVKTYALENAPDPYADQSNVEKYIEKQLNSEGSEIKDISKMTDEEIREKLRIIK
HEQEEKRKKSQEVVDFTDPADRVEGTMIDNNSKTRLDPPPDGQPWAQYELERKVPDGLVG
NGGLVNATLFTLCRNSELYSILDSIHQLETRFNGKHHYDWVFLNDEPFSEEFIELTSNLI
SGRARYGLIPKKHWTYPEYVDQDKAREIRESRKWAQITYGSSESYRHMCRFNSLFFYKHP
IMEEYDYYWRVEPDVKFHCDIMQDPFKYFLENKKKYGFTISMRELPNTIETLWDTSKLYF
GQLQEDYFSKENREKNLADFITDDSGASYNLCHYWTNFEIADLSIYRNEIYQGYVEHLDR
AGGFFYERWGDAPIHSIIFSLMLSKKEIHLFQDISYEHTVGKSCPLNRELHRKAQCICDP
EDNWVLTSDSSCNLKFLDVVEDAKPPELEAYLQRIANKKLEEEELRQEQRKLRMETARRS
SEARRRKAEERRKARIAAKEAHRNKQKEQQ
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgtatctattgagaagatataggtcactccttccatatgttttcgtgtctgtgtttgcc
ttggggataattttctctgtttacgtttccaaatccgagaatgatattagaaagcttgat
ggtttcaacgccgacccaattgaaaattcacaacctggaactcctgaagctgttgaagag
aaaccaaatgacgacgcagacgtcaaaacatatgcgttggagaatgcccctgatccttac
gccgaccaaagcaatgtggaaaaatatattgaaaaacaattgaacagtgaaggatcagag
attaaagatatctcaaagatgacagacgaagaaataagggagaagctacggatcataaag
catgaacaagaagagaagagaaagaaatcacaagaagtggttgattttactgatcctgca
gatagagttgaagggaccatgattgacaataattctaaaacgaggttggaccccccgcca
gatggccagccttgggcacagtatgagcttgaaaggaaagtgccggacggattagttggt
aatggaggactagtcaatgcgacactgtttacgttatgtcgaaattccgagctttattcc
atattggactcgatccatcagttggagacccggttcaatggcaagcatcattacgattgg
gtttttctgaatgatgagccattcagtgaggagtttatcgagttgacatcgaatctaatc
agcgggcgtgctagatatggattgattccaaagaaacactggacgtatcctgaatatgtc
gatcaagacaaggcacgtgagattcgtgaaagtcgaaaatgggcgcaaatcacctatgga
tcaagcgaatcatacagacatatgtgtaggttcaactcgttgtttttctacaaacatccg
atcatggaggagtatgattattattggagggttgaaccagatgttaaattccactgtgac
attatgcaggatccattcaaatacttccttgagaacaaaaaaaagtatggatttaccatt
tccatgagggaattaccgaatacgattgagacactatgggataccagcaaactgtatttt
gggcaactccaagaagattatttctccaaggagaaccgagagaagaatctggccgacttt
ataaccgacgattctggggctagttataacctttgccattactggacaaattttgagatt
gcagacttgagtatctatagaaacgaaatctatcaaggatatgttgaacatttagatcgt
gctggagggtttttctatgagaggtggggggatgcgccaatccactctattattttcagt
ctaatgttgagtaagaaggagatccatctgtttcaagatatcagttacgagcatactgtt
ggaaagagctgtccattaaaccgggaactacatcggaaggcgcaatgtatctgtgatccg
gaggataactgggtgttgaccagtgacagcagttgtaatttaaaatttcttgatgttgtt
gaagatgcaaagccgcccgaattggaggcgtacctgcagcggattgccaacaagaagttg
gaggaggaggaattacgacaagagcagcggaaactacggatggagacggcacggcgaagc
agtgaggcacgtcgtaggaaagccgaagagagacggaaggcccggattgctgccaaggaa
gcccataggaataagcagaaagagcaacagtag

DBGET integrated database retrieval system