KEGG   Parvibaculum lavamentivorans: Plav_2722Help
Entry
Plav_2722         CDS       T00580                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
pla  Parvibaculum lavamentivorans
Brite
KEGG Orthology (KO) [BR:pla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pla03012]
    Plav_2722
   03029 Mitochondrial biogenesis [BR:pla03029]
    Plav_2722
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pla04147]
    Plav_2722
Translation factors [BR:pla03012]
 Eukaryotic Type
  Elongation factors
   Plav_2722
 Prokaryotic Type
   Plav_2722
Mitochondrial biogenesis [BR:pla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Plav_2722
Exosome [BR:pla04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Plav_2722
  Exosomal proteins of breast cancer cells
   Plav_2722
  Exosomal proteins of colorectal cancer cells
   Plav_2722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: ABS64330
UniProt: A7HWP7
LinkDB All DBs
Position
2928299..2929489
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERNKPHCNIGTIGHVDHGKTSLTAAITKVLAETGGATYSAYDQIDKAPEEKARG
ITISTAHVEYQTEARHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDQVDDPELLELVEMEIRELLSSYDFPGDDIPIVKGSALAALE
DSNKEIGHDAILELMKAVDAYIPQPERPKNLPFLMPIEDVFSISGRGTVVTGRIERGVVK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGEAGDNVGVLLRGTKREDVERGQVLCAPGS
ITPHTEFEAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVK
MNVTLIAPIAMEEKLRFAIREGGRTVGAGVVSKVLK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaagagaagtttgagcggaacaagccgcactgcaacatcgggacgattggtcac
gtagaccatggcaagacgtcgcttacggcggcgatcacgaaggtgcttgcggagacgggc
ggggcgacgtattcggcctatgaccagatcgacaaggcgcctgaagagaaggcacgcggg
atcacgatctcgacggcgcatgtggagtatcagacggaagcgcgccactacgcgcatgtc
gactgccccggccatgcggactatgtgaagaacatgatcacgggcgcggcgcagatggac
ggggcgatcctcgtcgtgtcggcggccgacggtccgatgccgcagacgcgcgagcacatc
ctgcttgcccgtcaggttggcgtgccggcgcttgtggtgttcatgaacaaggttgaccag
gtcgacgatccggagcttctggagcttgtcgagatggaaatccgtgagcttctttcgtct
tacgacttcccgggcgacgatattccgatcgtgaagggctcggcgcttgcggcgcttgaa
gactcgaacaaggaaatcggtcacgacgcgatcctcgagctgatgaaggcggtcgacgcc
tacatcccgcagccggagcgtccgaagaacctgccgttcctgatgccgatcgaagacgtg
ttctcgatctcgggccgcggcacggttgtgacgggccgtatcgagcgcggtgtcgtgaag
gtcggcgaggaaatcgagatcgttggcatcaagccgacggtgaagacgacctgcacgggc
gtcgagatgttccgcaagctgctcgaccagggcgaggctggcgacaatgtgggcgttctc
ctgcgcggcacgaagcgtgaggacgtcgagcgcggccaggttctgtgcgcgcccggctcg
atcacgccgcatacggagttcgaggcggaagcctatatcctgacgaaggaagagggtggc
cgtcatacgccgttcttcacgaactaccgcccgcagttctacttccgcacgacggacgtg
acgggtgtggtgacgctgcccgagggcaccgaaatggtgatgccgggcgacaacgtgaag
atgaacgtgacgctgatcgcccccatcgcaatggaagagaagctccgcttcgccatccgt
gaaggcggtcgtaccgtcggcgcaggcgtcgtctcgaaagtgttgaagtaa

DBGET integrated database retrieval system