KEGG   Parvibaculum lavamentivorans: Plav_2844Help
Entry
Plav_2844         CDS       T00580                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00970  Aminoacyl-tRNA biosynthesis
pla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pla00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Plav_2844
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pla03029]
    Plav_2844
Enzymes [BR:pla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Plav_2844
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Plav_2844
Mitochondrial biogenesis [BR:pla03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Plav_2844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Aconitase_B_N
Motif
Other DBs
NCBI-ProteinID: ABS64451
UniProt: A7HX18
LinkDB All DBs
Position
3048756..3050273
Genome map
AA seq 505 aa AA seqDB search
MTTMVSDFERTMRKREARPEDLIKGQTGDWEIILGLEVHAQVTSNAKLFSASSTKFGAEQ
NTQVSFVDAAMPGMLPVINRYCVEQAVRTGLGLKAQINLRSVFDRKNYFYPDLPQGYQIS
QYKHPIVGEGEVVLDMKDGRTVIVGIERLHLEQDAGKSLHDQHPAMSFVDLNRSGVALME
IVSKPDMRSADEARAYVTKLRTILRYLGTCDGNMEEGSLRADVNVSVRKVGAPLGTRCEI
KNVNSIRFIGQAIEYEARRQIEILEEGGKIDQETRLFDPKTGETRSMRSKEEAHDYRYFP
DPDLLPLELLQDDVDAIRTSLPELPDEKKARLISDYGLSPYDATVLVSEGARADFFEAVA
KGRDAKLAANWVTGDFFGALNREGHSIEDTPVTAKQLGELIDLISDGTISGRIAKQVFDS
MYKTGRDPAKIVEDEGLQQVTDFGEIEAAIDAVIAANPDKVEQTKVKPQLAAWFVGQIMK
STSGKANPRVVNEILARKLGLSSEG
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatggtgagcgatttcgagcgcacgatgcgcaagcgcgaggcgcggccggaa
gacctgatcaaagggcagacaggcgactgggagatcattctcgggctcgaagtccatgcc
caggtgacgtcgaacgccaagcttttctcggcttcttccaccaagttcggcgcggaacag
aacacgcaggtgagcttcgtggacgcggcgatgccgggaatgctgccggtcatcaaccgc
tactgcgtggaacaggcggtgcgcacggggctcggcctcaaggcgcagatcaacctgcgc
tcggtgttcgaccggaagaactatttctacccggacctgccgcagggctaccagatctcc
cagtacaagcatccgatcgtgggcgagggcgaggtcgtgctcgacatgaaggacgggcgg
acggtgatcgtcggcattgagcggctgcatctggaacaggacgcgggcaagagcctgcac
gaccagcaccccgcgatgagcttcgtcgacctcaatcgttcgggcgttgcgctgatggag
attgtctcaaagccggacatgcgttccgcagacgaagcaagggcttacgtgacgaagctg
agaacaatcctgcgctatctcggtacctgcgacggcaacatggaagagggaagtctgcgc
gccgacgttaatgtttctgtgcgaaaggtcggcgccccgctcggcacgcgctgcgaaatc
aagaacgtgaactcgatccgtttcatcgggcaggcgatcgaatacgaagcgcggcggcag
atagaaatcctcgaagagggcggcaagatcgaccaggagacgcgacttttcgatccgaag
acgggtgaaacgcgctcgatgcgctccaaggaagaggcgcatgactatcgctacttcccc
gatcccgatcttctgccgctggaactactgcaggacgatgtggacgccatccggacgtcg
ctgccggaactgccggacgaaaaaaaggcgcgactgatctccgactacgggctgtcgccc
tacgacgcgaccgttctggtaagcgaaggcgcccgcgcggacttcttcgaggcggttgca
aaagggcgcgacgcgaagctcgcggcgaactgggtgacgggcgatttcttcggggcgctg
aaccgcgaaggacactcgatcgaggacactccggtgaccgcgaaacagctcggagagctc
atcgacctcatctccgacgggacgatctcggggcgaatcgcgaagcaggtttttgattcg
atgtacaaaacgggccgtgacccggccaaaatcgtcgaagatgaaggcctgcagcaagtc
acggattttggagaaatcgaggccgcaatcgacgccgtcatcgcggcgaaccccgataaa
gtcgagcaaacaaaagtcaagcctcaacttgcggcgtggtttgtcggccaaatcatgaaa
tccacgtctggcaaggctaatccgcgcgtcgtgaatgaaattcttgcgcgaaaactgggg
ctatcgtccgaaggctga

DBGET integrated database retrieval system