KEGG   Parvibaculum lavamentivorans: Plav_2977Help
Entry
Plav_2977         CDS       T00580                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pla00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Plav_2977
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pla03400]
    Plav_2977
Enzymes [BR:pla01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Plav_2977
DNA repair and recombination proteins [BR:pla03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Plav_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ABS64584
UniProt: A7HXF1
LinkDB All DBs
Position
complement(3172901..3175438)
Genome map
AA seq 845 aa AA seqDB search
MSRKSTSSLETYWAKRHFDETPEPRGKKARRKGHRYSIQMHHTRRLHYDLRLELDGVLKS
WAITKGPSLDPSVKRLAVRTEDHPVDYIAFEGNIPEGHYGAGTVLLWDRGEWQPIGDPHE
GLKKGKLAFEIHGERLKGRWALIRFKGERDPKRENWLLIKERDDVASSSKDPVEEYKTSV
SSGRGKKEVSDAPDRVWEDGKAKKAKSKRVTSKGPKHPLPGFVEPALATLVDEPPSGDDW
LFEMKYDGYRALASVTGEEVRIFTRSGLDWTERYGALGSAFSDLGLDGALIDGEIVVTDA
KGRSSFSDLQRTLKGEKKGRLSFFAFDLLHSEGEDLRKRPLIERKKQLKALLGAAGKKGP
VYYTDHVEGEGEMMLEALCTRGFEGVIAKRADRPYRSGRGKSWLKIKCQHEQEFVIVGWS
PSERGRAFSSLLLALREDGELRYAGRVGTGFSEADLNALSKRFASLARRTSPLKGDVPAE
IRRNVRWLRPELVAQIGFAEFTHDGAVRQARYLGLREDKPASAVTRESAVPVEKIEKMTA
TDKTSKDADDDAVIEGVRITHPDRILFPEQGVTKLALARYMQKAAPLMLPHLANRLLSLV
RCPQGPQKKCFFQRHAGSSLPEGFKELPVKGSKERQDYLYLTDAKGLVAAAQMGVLELHL
WGSHIDDVERPDRIVFDLDPDPDLPFDTVIEAARRMRNVLEALELQSYPMLTGGKGVHVV
APLVRRHEWPVVKAFTRALAERLEADAPERYVAKMTKSKRTGRIFIDYLRNDRSSTAIAP
YSPRARKGAPVAWPVTWEELDEANSGGDVTIETAFAKRRTDPWKGYGSLRQSLKASALRA
LDVDA
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgcaagagtacgtccagcctcgaaacctattgggcgaagcgtcattttgacgaa
acacctgaacctcgcggcaagaaagcgcggcgcaagggccatcgctattcgatccagatg
catcatacccgtcggctgcactacgaccttcgcctggaactcgatggcgttctgaagagc
tgggccatcacgaaaggtccgagcctcgatccttctgttaagcgcctcgccgtccgcaca
gaggatcacccggtcgactacatcgcctttgagggaaacatcccggaaggtcactacggc
gccgggacggtgcttctatgggatcgcggcgaatggcaaccgatcggcgatccgcatgaa
ggcctgaagaaaggcaagctcgcttttgaaattcatggcgagcgactgaaaggacgatgg
gcactcatccgtttcaagggcgaacgcgacccgaagcgggaaaattggctcctcataaag
gagcgcgacgatgtcgcaagcagcagcaaagaccctgtcgaagaatacaagacaagcgtc
tcttctggtcgcggcaaaaaggaagtctcggacgcacccgatcgtgtctgggaagacggc
aaggcgaagaaggccaagtcgaagcgggttacatcgaagggcccgaaacatcctttgccc
ggctttgtcgaaccagccctggcaacgctcgtggatgagccaccgtcaggagatgattgg
ctgttcgaaatgaaatacgacggataccgcgctctcgcctctgtaacgggagaagaggtc
cgcattttcacccgaagcggcctcgattggactgaacgctacggcgcacttggttctgcg
ttttctgaccttggtcttgatggcgcgctgatcgatggtgagatcgtcgtcaccgacgcg
aaaggccgctcgagcttcagcgatctgcaacgcacattgaaaggtgagaaaaagggacgc
ttgtcttttttcgccttcgatctcctccattccgaaggcgaagatctgcgcaaaagaccg
ttgatcgaacgcaagaagcagctgaaagcactgctcggtgcggccgggaagaaaggcccc
gtctattacaccgaccatgtggaaggtgagggagagatgatgctcgaagcgctctgcacg
cgcggcttcgaaggggtgatcgccaaacgcgccgaccggccgtatcgctccggacgtgga
aagtcctggctgaagatcaaatgccagcatgaacaggagttcgtcattgtcggttggtct
ccctcggagcgcggccgggcattctcctcgctcctgctggctcttcgggaggatggcgag
ctacgctatgcaggcagggtcggcacaggcttttccgaggccgacctgaatgcactttca
aagcgtttcgcctctttggcgcggcgcacctcaccgctcaagggcgatgtgcccgccgag
atcaggcgcaacgtgcgttggctgcggcccgaactcgtggcccagatcggatttgccgag
tttacccatgacggcgccgtgcggcaggcgcgctacttgggcttgcgcgaggacaagccc
gcaagtgccgtcacgcgcgagagcgccgttccggtggagaagatcgaaaaaatgacagca
accgacaaaacctcgaaagatgccgacgacgacgcagtcattgaaggtgtccgtatcact
catccggaccgcattctttttccagagcaaggcgtcaccaaactcgcgctcgcgcgatac
atgcaaaaagccgcaccgcttatgctgccgcacctggcaaaccgcctgctcagtctcgtg
cgttgcccgcagggaccgcagaaaaaatgtttcttccagcgacatgccggctcgagcctt
cccgaaggcttcaaggaactgccggtaaagggatcgaaagaacggcaggactatctctat
ctgacggatgccaagggccttgtcgccgccgcacaaatgggtgtgctggagctccatctg
tggggctctcatatcgacgatgtcgaacgccctgacaggattgttttcgatctcgatccg
gaccccgatctccctttcgacacggtgatcgaagccgcgcggcgaatgcgcaatgtgctg
gaagctctggagctgcagagttatcccatgcttaccggtggcaagggcgtccacgtcgtc
gcgcctttggtgcgccgccatgaatggccggtcgtgaaggctttcacgcgtgcgctcgct
gagcggctggaggcagacgccccggagcgttatgtcgcgaaaatgaccaaatcaaagcgc
accggccgcatattcatcgactacctgcgaaatgaccgctcatctaccgccatcgcgccc
tactcgccccgcgcacgaaaaggagcgccggtcgcatggccggtaacctgggaggaactc
gacgaggcgaactccgggggcgacgtgacgatagaaactgcctttgccaagcgccgcacc
gatccatggaagggttatggctcccttcgacagtcactcaaggcatcggccttgcgtgca
ctcgatgtcgacgcctga

DBGET integrated database retrieval system