KEGG   Parvibaculum lavamentivorans: Plav_3306
Entry
Plav_3306         CDS       T00580                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00521  Streptomycin biosynthesis
pla00523  Polyketide sugar unit biosynthesis
pla00525  Acarbose and validamycin biosynthesis
pla01055  Biosynthesis of vancomycin group antibiotics
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pla00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Plav_3306
   01055 Biosynthesis of vancomycin group antibiotics
    Plav_3306
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Plav_3306
   00525 Acarbose and validamycin biosynthesis
    Plav_3306
Enzymes [BR:pla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Plav_3306
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 3Beta_HSD adh_short NAD_binding_10 KR Sacchrp_dh_NADP
Other DBs
NCBI-ProteinID: ABS64911
UniProt: A7HYC8
LinkDB
Position
3540358..3541428
AA seq 356 aa
MRVIVTGGAGFIGSAVIRLLINETEHEVLNLDCLTYASDQAALSSVCEHPRYRFSHTDIR
KPDALRRVFRDYRPHLVMHLAAESHVDRSIDAPADFIETNVVGTVNLLETARSYWSSLDG
AEKRAFRFHHVSTDEVYGSLGAEGYFTEETAYAPNSPYSASKAASDHMVRAWHATYGIPV
VTSNCSNNFGPHQFPEKLIPLTIINAIEGKSLPVYGNGMNIRDWLFVEDHARALMTIALR
GRVGETYNVGGDAERTNIEVVRSICSLLDEILPHSSFRPHENLIRFVADRPGHDMRYAID
TSKIRRELGWQPVESFESGLRKTVEWYIDNRAIWTRLLLDRYQGERLGLMGARQAI
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgcgcgttatagttacaggcggcgctgggttcatcggatctgcggttatccggctttta
atcaacgaaaccgaacatgaagtgctcaacctcgactgcctgacttatgccagcgatcag
gccgccctctcttccgtctgcgaacatccgcgttacaggttttcccatacagatatccgc
aagcctgacgcactcaggagggtctttcgagattatcgcccccatctcgtgatgcatctg
gcggcagagtcgcatgttgatcgctccattgatgcgcctgcggattttatcgaaactaat
gtagtcggtacggtcaatcttcttgagactgcgcgaagctactggtcttctctcgatgga
gcggagaagcgcgcttttcggttccaccacgtgtcgaccgacgaggtctatggaagcctg
ggagcagaaggctacttcaccgaagaaacggcctacgctcctaattccccctactcagca
tcgaaggccgcatcggatcatatggtgcgcgcatggcatgcgacctatggcatacctgta
gtaacgagcaactgctcaaacaatttcggcccccatcagtttccggaaaaactgatcccg
ttgaccatcatcaacgccattgagggcaagagcctgccggtatacggcaacggcatgaat
attcgtgactggctgttcgtcgaggatcatgcgcgcgcgctcatgacgatagctctacgc
gggcgcgtcggtgaaacttacaatgtcggcggcgacgccgaacgcaccaacatagaagta
gttcgctccatctgcagccttctggacgagattttgcctcactcatcgtttcgtccccat
gaaaacctgatccggttcgttgccgaccggccaggccacgatatgcgttacgcgatagac
acatcgaaaatccggcgcgagttgggttggcagccggtcgaaagctttgaaagcggattg
agaaagactgttgaatggtacatcgacaacagagccatctggacgcggttgcttctcgac
cgctaccaaggtgaacggctaggccttatgggcgcccgtcaggcgatatga

DBGET integrated database retrieval system