KEGG   Parvibaculum lavamentivorans: Plav_3634Help
Entry
Plav_3634         CDS       T00580                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00061  Fatty acid biosynthesis
pla00780  Biotin metabolism
pla01100  Metabolic pathways
pla01130  Biosynthesis of antibiotics
pla01212  Fatty acid metabolism
Module
pla_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pla00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Plav_3634
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Plav_3634
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosyntheses
    Plav_3634
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pla01004]
    Plav_3634
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Plav_3634
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Plav_3634
Lipid biosynthesis proteins [BR:pla01004]
 Fatty acid synthase
  Component type
   Plav_3634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: ABS65232
UniProt: A7HZ99
LinkDB All DBs
Position
complement(3891445..3892311)
Genome map
AA seq 288 aa AA seqDB search
MHGSGGEKAGEGALVLTGPLMKGRRGLIMGVANDHSIAWGIARALAAHGAELAFTYQGES
FGRRVKPLAASAGSKLLLPCDVTDPASLDAAFETLEKEWGVLDFVVHAIAHSDKNELKGR
YVDTTRENFLRTMDISCFSFTDVARRAAKLMTRGGSMVTLTYGGSTRVMPNYNVMGVAKA
ALEASVRYLAVDLGRHGIRVNAISAGPMRTLAGSAVGDARFVFKWNKTHAPIKESIELDH
VGGAGLYLLSDLSARVSGEVHHVDGGYNIIGLPRAEELKASQPEGGEG
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcatggttctggcggagagaaggcgggcgaaggcgcattggtgctgacagggccgctg
atgaagggccggcgcggccttatcatgggtgtggcgaacgatcactcgatcgcctggggc
attgcgcgggcgctggcggcacatggcgcggaactcgccttcacctatcagggcgaaagc
ttcggacggcgcgtgaagccgctggcggcatccgccggctcgaagctgctgctgccttgc
gacgtgacggacccggcgagcctcgatgcggctttcgagacgctggagaaggaatggggc
gtgctcgacttcgtggttcacgccatcgcgcattccgacaagaacgagctcaagggccgc
tatgtcgacacgacgcgggaaaacttcctgcgcacgatggatatttcctgcttctccttc
accgatgtggcgcggcgcgcggcaaagctgatgacgcggggcggctcgatggtgacgctg
acctatggcggctcgacgcgcgtcatgccgaactacaatgtgatgggcgtggcgaaggcc
gcgctcgaggcgagcgtgcgctatctcgcggtcgatctcggccggcacggcattcgcgtc
aacgcgatttcggcaggtccgatgcgcacacttgcgggctcggcggtcggcgatgcgcgg
ttcgtgttcaagtggaacaagacacatgcgccgatcaaggaatcgatcgagctcgaccat
gtgggcggcgccgggctttacctgctctccgatctttcggcgcgggtttccggcgaggtg
catcatgtcgatggcggctacaacatcatcggattgccgcgcgcggaagagctgaaggcg
agccagccggagggcggcgagggctga

DBGET integrated database retrieval system