KEGG   Plantactinospora sp. BC1: C6361_04295Help
Entry
C6361_04295       CDS       T05377                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
plab  Plantactinospora sp. BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding Condensation PP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AVT28848
LinkDB All DBs
Position
complement(1035252..1040915)
Genome map
AA seq 1887 aa AA seqDB search
MALQPRPGAGLRRYRRGERHRLERGGRLRGDRAAVDADGGGPGRPERRPLGAGHRQFGAR
LPPPPHRPARRLAYRPDAAVVLAARRHRGGGRGHPDPAAVAGPDDREEGNVTDVPAQHRS
TLADVLRWRSEEQPERLAFAFLGDEPDAEVRWDYRTLDSRARAVAAALRDRCVPGDRALL
LHPPGPEYVAALFGCWYAGIVAVPAYPPRAGTRTERLVAIADDARPAVALTTAALGDAVS
TNWSGATIATDTLTEPAGEPESGPADGSTAALLQYTSGSTAAPKGVLLSHDNLTANSTHI
QRSFASGPESHAVVWLPPYHDMGLIGGLLQPVWAGFPATLMAPTAFLRQPLRWLRAISDT
RADCSGGPNFGYEMALRRVRPEQLAELDLSAWRVAFSGAEPVRADTLRRFAEYFAPCGFR
EDAFYPCYGLAEATLLVTGAPAGRPPVSARFDRDALAEGRAVASTAGTEIVGCGRSMPGQ
SVRVVDPQTAEAVPDGRVGEIWVSGPSVAQGYWDRPAETARTFAARLAGDPDERSWLRTG
DLGFLRDGELFVTGRLKDLVILRGRNHYPQDIEATAQRADPVLRPDCGAAFGVPVDGEER
LVVVQEVERGQTVDHAAVTAAIRTRVAAEHDVVPYAVLLTRPATIPRTTSGKVRRERCRE
LYLAGELVGLAHDVLEPAPDGEVDEPATVTPADLAAADPHTRRRIVTELVRLGAARVARQ
PAEGFDTARPLVSYGIDSVSAVGLQHRIETATGVPVAVGTLLGGGSADDLVDEVLTGLAA
AARPAAEPGTGGGPDGEPTPNQRALWTLQRILPDSTANNLGCAVRVTGTLDVSALHRALR
DLVERHDALRTSYPSRSGVPVAVVHEAVDGWFGHVDVTGLSSAALLQRCADEADRPFDLA
RGPLLRVRLYTGAGDPLLLLAAHHICLDLWSAELLLTELGERYRAALGGQGATDRPPAPP
YAGYAARHLRAVTGPGAEPARSYWTRRLAGAPPRTVLPAPGIRPPVRRFRGATRHSDLPG
DLVDGLRALAAAEGTTLFTLLLAAYTALIHRYSGASDLVVGTPAGARVRPGDADVVGYVS
NLLPLRSTVSGEPSFRTLLGQVRRELLAALERQEYPFAFVADALGGTHDLSHAPVFQTMF
AVAAAHPGGDAALAGLVLGIPGQHGRLGPLEVDAVPLPRVATPFELTLTVAETPTGAVAS
WTYDTDRYDADTVERFAEGYGALLAAVVADPDQPVSRAPLMSAASREWLLSVLTGDRAAG
ADAGGSVLERLVRVAGSSGDAVALSDDSGVSVTFAEVAELAGRLAGVLRSAGVVRESPVG
VCVPRGVDLPVVVLAVWWAGGVYVPLDPSLPAGRLAEMAGAAGVSVLVSGVDGAVPDFTG
RVVDVSGGVAGVVGDGVVAPVGPVVGQGAFVVFTSGSTGRPKGVVVEHGQLWNRLVWMWE
GFGFGVGEVVCQKTSVGFVDSVWELVGGLLAGVRSVVVSDEVSRDPVRLVEVLARERVTR
LLLVPSLLRSILDAVPDLGARLPELRMWVSSGEALPWSLWHRFQTAMPHARLVNLYGSSE
AWDTACCTEPGSAPVAASVPIGRPIRGVRVYVLDGVGELVPVGVPGELWVGGAAVSRGYL
GEPGLTAERFRPDPFGVVGGRMYRTGDLACVLPDGQVQFLGRVDHQVKVRGVRVEPAEVE
AALERHPEVRTSVVVSHPDAAGRDRLVAYVVPAGERRPTVTALRAYLHERLPDAFVPSTF
VHLAELPRNASGKVDRPALPPPTGERPHLDGAFVAPRSVVERRLSEIWAEVLGVDRVGVQ
DNFFDLGGTSLTLVEVHERIVAAFDVDMPVVRLFQNPTIQALVAHLDGGAAEGADRLRRG
AEDAARRRRALAGGRARTARAAGTEPQ
NT seq 5664 nt NT seq  +upstreamnt  +downstreamnt
gtggctcttcaaccacgacccggtgccggtctccggcggtaccgacgcggtgaacgccac
cgcctggaacgcggcggacggctacgaggtgaccgagctgccgtcgatgcggatggcggt
ggacctggccgacctgaacgccgcccgctgggtgcaggtcaccggcaattcggggcacgc
ctaccacccccaccacaccgaccagctcgacgtctggcgtaccggccggatgctgcggtg
gtactggctgcgcgccgacatcgaggcggcggccgaggacaccctgaccctgcggccgta
gccgggccggacgaccgggaggaaggcaacgtgacggacgtaccagcccagcatcgatcg
acgcttgccgatgtgttgcgctggcgctcggaggagcagccggagcgcctcgccttcgcg
ttcctcggcgacgagccggacgccgaggtgcgctgggactaccggacactcgactcgcgg
gcccgtgccgtcgccgccgccctgcgcgaccggtgcgtccccggcgaccgggcgctgctg
ctgcacccgcccggcccggaatacgtcgcggccctcttcggctgctggtacgccggcatc
gtcgccgttccggcctacccgccacgggccggcacccgcaccgaacgactggtcgcgatc
gccgacgacgcccgaccggccgtggcgctgaccaccgccgcgctcggcgacgccgtctcg
accaactggagcggcgcgacgatcgccaccgacacgctgaccgaaccggccggcgagccc
gaatccggcccggccgacggatcgacggccgcgctgttgcagtacacctccggctccacg
gccgcgcccaagggcgtcctgctcagccacgacaacctcaccgccaactccacgcacatc
cagcgctccttcgccagcggaccggagagccacgccgtggtgtggctgccgccgtaccac
gacatggggctgatcggcgggctcctccagccggtctgggccggcttcccggccaccctg
atggcaccgaccgccttcctgcgccagccgctgcgctggctacgcgccatcagcgacacc
cgcgccgactgcagcggcggccccaatttcgggtacgagatggcgctgcgccgggtccgc
ccggagcagctcgccgagctggacctgagcgcctggcgggtcgcgttcagcggcgccgag
ccggtgcgggccgacaccctgcgccggttcgccgaatacttcgccccgtgcgggttccgc
gaggacgccttctacccctgctacgggctcgccgaggcgaccctgctcgtcaccggtgcc
ccggcgggccggccgccggtcagcgcccggttcgaccgggacgccctcgccgagggcagg
gccgtagcctccaccgccggcaccgaaatcgtcgggtgtggacggtccatgcccggccag
tcggtccgggtggtggatccgcagaccgccgaggccgtgccggacgggcgggtcggcgag
atctgggtcagtgggccgagcgtggcacaggggtactgggaccggccggcggagaccgcg
cggacgttcgccgcccggctggccggcgacccggacgaacgctcctggctgcgcaccggc
gacctgggtttcctgcgcgacggcgaactcttcgtcaccggccggctcaaggacctcgtc
atcctgcgcggccgcaaccactacccgcaggacatcgaggcgaccgcccagcgggccgac
ccggtgctccgccccgactgcggcgccgcgttcggggtgccggtcgacggcgaggagcgg
ctggtcgtcgtccaggaggtggaacgcggccagaccgtcgaccacgccgccgtcacggcc
gccatccgcacccgggtcgcggccgagcacgacgtcgtgccgtacgcggtgctgctgacc
cggccggccaccatcccgcgtaccacgagcggcaaggtacggcgggagcgctgccgcgag
ctctacctggccggggaactcgtcgggctcgcccacgacgtcctggaacccgccccggac
ggggaggtcgacgaacccgccacggtgacaccggccgacctcgccgccgccgacccgcac
acccgacggcggatcgtcaccgagctggtccggctcggcgccgcccgggtggcccggcag
ccggcggaggggttcgacaccgcccggccactcgtctcgtacggcatcgactcggtgagc
gcggtcgggctccagcaccggatcgagacggccaccggggtaccggtcgccgtcggcacc
ctgctcggcggcggcagcgccgacgacctcgtcgacgaggtcctcaccgggctcgccgcc
gcggcccgacccgccgccgaaccaggcaccggcggcggcccggacggcgagcccacgccc
aaccagcgggcactgtggacgttgcagcggatcctgcccgactcgaccgcgaacaacctc
ggctgcgcggtacgggtcaccggcaccttggacgtctcagccctgcaccgtgcactgcgg
gacctcgtcgagcggcacgacgccctgcgcaccagctatccgtcccggagcggcgtgccg
gtcgcggtggtgcacgaggcggtcgacggctggttcggacacgtcgacgtcaccggtctg
agcagcgccgcgctgctccagcggtgcgccgacgaggccgaccggcccttcgacctggcg
cgcgggccgctgctgcgggtacggctctacaccggggccggcgacccgctgctgctgctg
gccgcacaccacatctgcctggacctgtggtcggccgaactgctcctgaccgaactcggc
gagcggtaccgtgccgctctcggtggacagggcgcgacggaccggccgcccgcaccgccg
tacgccgggtacgccgcccggcacctccgcgcggtcaccgggccgggggccgagccggcg
cggtcgtactggacccggcggctggccggcgcaccgccgcgtaccgtgctgcccgccccc
ggcatccgtccgccggtccggcggttccggggagcgacccggcacagcgacctccccggc
gatctggtcgacgggctacgcgccctcgcggcggccgaggggacgacgctcttcaccctg
ctgctggccgcctacacggccctgatccaccgttacagcggcgcgtctgacctggtcgtc
ggcaccccggccggtgcccgggtccggcccggcgacgccgacgtggtgggctacgtgtcg
aatctgctgccgctgcgcagcaccgtctccggcgaaccgtcgttccgtaccctgctcggc
caggtccgtcgagagctgctggccgccctggagcgtcaggagtacccgttcgcgttcgtc
gccgacgcgctcggcggcacccacgacctgagccacgcgccggtgttccagaccatgttc
gccgtcgccgccgcccaccccggtggcgatgccgcgctggccggcctcgtcctcggcatc
cccggccagcacggccggctcggcccgctcgaggtcgacgcggtgccgctgccccgggtg
gccaccccgttcgaactgacgctgaccgtcgccgagaccccgaccggggcggtcgcctcc
tggacctacgacaccgaccggtacgacgccgacaccgtcgaacggttcgccgaggggtac
ggcgccctgctcgccgccgtcgtcgccgacccggaccagcccgtctcgcgggcaccgctg
atgtcggcggcgtcgcgggagtggctcctgtcggtgctgaccggtgaccgggctgccggt
gctgatgccggtggatccgtgcttgagcggttggtgcgggtggcgggttcgagcggggac
gcggtggcgttgtcggacgactccggtgtgtcggtgacgttcgccgaggtggcggagttg
gcgggtcggttggcgggggtgttgcgttcggcgggggtggtgcgggagtcgcccgtcggg
gtgtgtgtgccgcgtggggtggatctgccggtggtggtgctcgcggtgtggtgggcgggt
ggggtgtacgtgccgttggatccgtcgttaccggctgggcggttggcggagatggcgggt
gcggcgggtgtttcggtgctggtgtccggtgtggacggtgcggtgccggactttacgggt
cgggtggtggatgtgtccgggggtgtggctggggttgtgggtgacggggtggtggcgccg
gtgggtccggtggtggggcagggggcgtttgtggtgttcacgtcggggtcgacggggcgg
ccgaagggtgtggtggtggagcacgggcagttgtggaatcggttggtgtggatgtgggag
gggtttggttttggggtgggggaggtggtgtgtcagaagacgagtgtgggttttgtggat
tcggtgtgggagttggtgggtgggttgttggcgggggtgcggtcggtggtggtctcggac
gaggtctcccgggacccggtacgactcgtcgaggtgctcgcccgcgagcgggtgacccgg
ctgctgctggtgccgtcgctgctgcgctccatcctggacgcggtgccggacctgggtgcc
cggttgccggagctgcggatgtgggtgagcagtggtgaggcgttgccgtggtcgttgtgg
caccgcttccagaccgcgatgccgcacgcccggctggtcaacctctacggctcctccgag
gcatgggacaccgcctgctgcaccgagcccggatccgcaccggtggcggcgtcggtgccg
atcggtcggccgattcggggtgtgcgggtgtatgtgctggatggggtgggggagttggtg
ccggtcggtgtgccgggagagttgtgggtgggcggtgcggcggtgtcgcggggttatctg
ggtgagccggggttgacggcggagcgttttcggccggatccgttcggggtggtgggtggg
cggatgtatcggaccggggatttggcgtgtgtgttgccggatgggcaggtgcagttcctg
ggccgggtggatcatcaggtgaaggttcgtggtgtgcgggtggagccggccgaggtggag
gcggccctcgaacgccatcccgaggtacggaccagcgtggtggtcagccatcccgacgcg
gccgggcgggaccggctggtggcgtacgtggtgccggcgggggagcgccggccgaccgtc
accgcgctgcgggcgtacctgcacgaacggctgcccgacgcgttcgtgccgtccaccttc
gtgcacctcgccgagctgccccgcaacgccagcggcaaggtcgaccggcccgcgctcccg
ccgcccaccggcgagcggccgcacctcgacggcgccttcgtcgccccgcgctccgtggtc
gagcgccggctcagcgagatctgggcggaggtgctcggcgtggaccgggtcggcgtgcag
gacaacttcttcgacctcggcggcacctcgctgaccctggtcgaggtgcacgaacggatc
gtcgcggcgttcgacgtcgacatgccggtggtccggctcttccagaacccgacgatccag
gccctcgtcgcccacctggacggcggggcggccgagggagccgaccggctgcgccgtggc
gccgaggacgcggcgcggcgccgtcgggccctggccgggggccgcgcccgcaccgcccgc
gccgccggaaccgaaccgcagtga

DBGET integrated database retrieval system