KEGG   Plantactinospora sp. BC1: C6361_14055Help
Entry
C6361_14055       CDS       T05377                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00500  Starch and sucrose metabolism
plab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C6361_14055
Enzymes [BR:plab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     C6361_14055
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     C6361_14055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C GHL5 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AVT30432
LinkDB All DBs
Position
complement(3266156..3267811)
Genome map
AA seq 551 aa AA seqDB search
MTDRWYAEAVVYCLDIDTYADSDGDGIGDIRGLIGRLDYLARLGVTCLWLHPIHPSTQRD
DGYDATDFYGVDPRLGTLGDFAELLHQAANRGIKVIIDLVVNHTSDQHPWFVSARSSPDS
PYRDWYVWSDEAPPDRRQGMVFPGEQDETWSYDRTAKAWFYHRFYRFQPDLNFGNPAVRA
EVKKIMSFWLQLGVAGFRIDAAPFIIELTEPGNPDSPKDFEFLTELRQHVQWRRADALLL
AEANVQPAQLVDYFGDSGGSANRLHMLFDFMLNGRLMLALARQDPEPIVDALRDTPALPP
GAQWATFLRNHDEIDLSRLTAEQRAQVYAEFGPDENMRIYDRGIRRRLASMLGNDRRRIE
MAYALQFSLRGTPVLRYGEEIGMGEDLSLPGRESIRTPMQWSGKPNAGFSSAPADKLVRP
VIDSGEFGYERVNVTAQRHDPKSLLAWFERMIRTLREAPEVGSGSCTHVDQEMPHGVLAH
RADGPTGCMLFLHNLGTRPAVVNLGALLPEADMPIDVLADREYPPVGKLDALELAGYGYR
WIRLYRSDLVE
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgacggaccggtggtacgcggaggcggtcgtctactgcctcgacatcgacacgtacgcc
gactcggacggcgacgggatcggcgacatcaggggcctgatcggccgcctcgactacctg
gcccggctcggggtgacctgtctctggttgcacccgatccatccctcgacccagcgcgac
gacggctacgacgccaccgacttctacggcgtcgacccccggctcggcaccctgggcgac
ttcgcggagctgctgcaccaggccgccaaccggggcatcaaggtcatcatcgacctcgtc
gtcaaccacacctcggaccagcacccgtggttcgtctccgcccgctcctcgcccgactcg
ccgtaccgggactggtacgtctggtccgacgaggcgccaccggaccggcgtcagggcatg
gtcttccccggcgagcaggacgagacctggagctacgaccggaccgcgaaggcgtggttc
taccaccgcttctaccgcttccagccggacctcaacttcggcaacccggcggtacgggcc
gaggtcaagaagatcatgtcgttctggctccagctcggggtggccggattccggatcgac
gcggcgccgttcatcatcgagctgaccgagcccggcaacccggactcgccgaaggatttc
gagttcctgaccgagctgcgccagcacgtccagtggcggcgggccgacgcgctgctgctg
gccgaggcgaacgtgcagccggcgcagctcgtcgactacttcggcgacagcggcggctcc
gcgaaccggctgcacatgctcttcgacttcatgctgaacggccggctgatgctcgcgctg
gcccggcaggacccggagccgatcgtcgacgcgctgcgggacaccccggcgctgccgccc
ggtgcccagtgggccaccttcctgcgcaaccacgacgagatcgacctctcccggctcacc
gccgagcagcgggcccaggtctacgcggagttcggcccggacgagaacatgcggatctac
gaccggggcatccggcgccggctcgcgtcgatgctcggcaacgaccggcgtcggatcgag
atggcgtacgccctccagttctcgctgcgcggcacgccggtgctccgctacggcgaggag
atcgggatgggggaggacctgtcgctgccgggtcgggagtcgatccgtaccccgatgcag
tggtccgggaagcccaacgccggcttctccagcgccccggccgacaagctggtccggccg
gtgatcgacagcggcgagttcggctacgagcgggtcaacgtcaccgcgcagcggcacgac
ccgaagtccctgctggcctggttcgagcggatgatccgtaccctgcgggaggcgcccgag
gtcggctccggctcgtgcacgcacgtcgaccaggagatgccgcacggggtgctcgcgcac
cgcgccgacggcccgaccggctgcatgctcttcctgcacaacctcggtacccggccggcc
gtggtcaacctgggcgcgctgctgccggaggcggacatgccgatcgacgtactcgccgac
cgggagtacccgccggtgggcaagctcgacgcgctggaactggccgggtacggctaccgc
tggatccggctgtaccgctccgacctggtcgagtga

DBGET integrated database retrieval system