KEGG   Plantactinospora sp. BC1: C6361_14985Help
Entry
C6361_14985       CDS       T05377                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
plab  Plantactinospora sp. BC1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AVT30570
LinkDB All DBs
Position
3482383..3483477
Genome map
AA seq 364 aa AA seqDB search
MELPINPPVEPMLAKSVPKIPTGPGMSYEPKWDGFRCIVFRDGDEVELASRGGKTMTRYF
PEVVAQARAQLPTRCAVDGELIVIRRDGPDGGPRLDFDLLSQRIHPAASRVNMLAETTPA
DLVAFDLLAIGDELLIDQPYERRRTRLVEALRGVVPPVHVTQTTTDPETAARWFEIFEGA
GLDGLVAKPADIPYEPGKRLMFKVKHTRTADVVVAGFRWHKSGPVVGSLLLGLHDEAGTL
HHVGVSASFSAARRAELLDELAPYREGVKEHPWVHGDHTSGQRIPGGPSRWSGTKSLEWE
PLRPELVAEVGYDAMEGDRFRHTAQFVRWRPDREPASCGYDQLDRPIRFDVDQVLRGDPL
APGA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggagctgccgatcaacccgccggtcgagccgatgctggccaagagcgttccgaagatc
cccaccggtccggggatgagctacgagccgaagtgggacggcttccggtgcatcgtcttc
cgggacggtgacgaggtcgagctggccagccggggcggcaagacgatgacccgctacttc
ccggaggtcgtcgcgcaggcccgggcgcagctaccgacccgctgcgcggtcgacggcgag
ctgatcgtgatccgccgggacggcccggacggcgggccccggctcgacttcgacctgctc
agccagcgcatccacccggccgcgtcccgggtcaacatgctggccgagaccactccggcc
gacctggtcgccttcgacctgctcgccatcggcgacgagctgctgatcgaccagccctac
gagcggcgccggacccgcctcgtcgaggcactgcgcggggtcgtacccccggtgcacgtc
acccagaccaccaccgacccggagacggcggcccggtggttcgagatcttcgagggcgcc
gggctggacgggctggtcgccaagcccgccgacatcccctacgagcccggcaagcggctg
atgttcaaggtcaagcacacccggaccgccgacgtggtggtcgccgggttccgctggcac
aagtccggcccggtggtcggttcgctgctgctcggcctgcacgacgaggcgggcacgctg
caccacgtcggcgtctcggcgtcgttcagcgccgcccgccgggccgagctgctcgacgag
ctggccccctaccgcgagggcgtcaaggagcacccgtgggtgcacggcgaccacaccagc
gggcagcgtatcccgggtgggccgagccggtggtccggcaccaagagcctggagtgggag
ccgctccgcccggaactggtggccgaggtcggctacgacgcgatggagggcgacaggttc
cggcacaccgcgcagttcgtccgctggcggcccgaccgggagccggcctcctgcgggtac
gaccaactcgaccgcccgatccggttcgacgtcgaccaggtgctccgcggcgacccgctc
gcccccggcgcgtag

DBGET integrated database retrieval system