KEGG   Plantactinospora sp. BC1: C6361_16130Help
Entry
C6361_16130       CDS       T05377                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C6361_16130
Enzymes [BR:plab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C6361_16130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4159 DUF4350 YacG
Motif
Other DBs
NCBI-ProteinID: AVT30750
LinkDB All DBs
Position
3735265..3737340
Genome map
AA seq 691 aa AA seqDB search
MSQTPHLVVTATDAPGQAGPLPRLDRLAYGGDYNPEQWPEHVWAEDVELMRTAGVNLVSV
GIFSWALLEPAEGSFDFGWLDRLLDRLHDGGISVDLATPTAVPPAWFRRRHPEARLVDRH
GVALGGGARQSFCPSSPAYAEASARITEALARRYAEHPALVLWHSHNEYGGVNALCYCAT
SAAAFRDWLRDRYGDLPRLNDAWGTTFWGQRYGDWAEIEPPLAAPTAVNPAQQLDFLRFS
SDAHLDNFRRERDILHRLCPGVPVTTNFMLANCKTIDYWRWADEVDVVSNDHYLRAEEPD
NHIELAMCADLTRAVARGRPWLLMEHSTSAVNWQPRNIAKRPGELRRNSLTHLARGAESV
LFFQWRAARFGAEKFHSAMLPHGGTETRIWREVVALGAELPALEPLRGTRVVADVAVLWD
WESWWAVELDWRPSVDLDYRERMAAYYERLWRDRLTVDFAHPERPLDDYRLVVVPSLYLT
TPAAAENLRRYVAGGGTLLVSYFSGIADADDAVHPGGYPGALRDLLGLTVEEFLPLRSGE
TLRLGPATGDASETGAAPLTGDVWAEAVLPHGAEPVLRYLDGPAAGGPAVTRHSLGAGHA
WYVSTRLDAAGLAPVLRAAYRDAGLVPPDGVPDGVELLRRAGADGSRFLIAINHADRDAE
LPATGTDLVDGSVHDGVLRVPAGGVRVLRTG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaccccgcatctggtggtaaccgcgacggacgcaccggggcaggccgggccg
ttgccccggctcgaccggctggcgtacggcggggactacaaccccgagcagtggcccgag
cacgtctgggccgaggacgtcgagttgatgcgtaccgccggggtgaacctggtcagcgtc
gggatcttctcctgggccctgctggagcccgccgaggggagcttcgacttcggctggctc
gaccggctcctcgaccggctgcacgacggcgggatatccgtcgacctggccaccccgacc
gcggtacccccggcctggttccgccggcgccacccggaggcccggttggtcgatcggcac
ggcgtagcgctgggcggcggagcgcggcagtccttctgccccagctcacccgcgtacgcc
gaggccagcgcccggatcaccgaggcgctggcccggcgctacgccgagcacccggcgctg
gtgctgtggcactcgcacaacgagtacggcggggtcaacgcgctctgctactgcgccacc
tcggcggccgcgttccgggactggctgcgcgaccggtacggcgacctgccccgcctcaac
gacgcctggggcaccaccttctggggccagcggtacggcgactgggccgagatcgagccg
ccgctcgccgcgccgaccgcggtcaacccggcccagcagctcgacttcctgcgcttctcc
tccgacgcgcacctggacaacttccgccgggagcgggacatcctgcaccggctctgcccc
ggcgtaccggtgaccaccaacttcatgctggccaactgcaagaccatcgactactggcgc
tgggccgacgaggtggacgtggtctccaacgaccactacctgcgggccgaggagccggac
aaccacatcgagctggcgatgtgcgccgacctgacccgggcggtcgcccggggccggccc
tggctgctgatggaacactccacctcggcggtgaactggcagccgcgcaacatcgccaag
cgccccggcgaactgcgccgcaacagcctgacccacctggcccggggcgccgagtcggtg
ctcttcttccagtggcgggccgcccggttcggcgcggagaagttccactccgcgatgctg
ccgcacggcggcaccgagacccggatctggcgcgaggtggtggcgctcggcgccgagctg
cccgccctggaaccgctgcgcgggacccgggtggtcgccgacgtcgcggtgctctgggac
tgggagtcctggtgggccgtcgagctggactggcgcccctcggtcgacctggactaccgg
gagcggatggcggcgtactacgaacgactctggcgggaccggctcaccgtcgacttcgcc
cacccggaacggccgctggacgactaccggctggtcgtggtgccgagcctgtacctgacc
accccggccgccgccgagaacctccgccggtacgtcgccggaggcggcacgctgctggtc
tcgtacttctccgggatcgcggacgccgacgacgccgtacatccggggggttatccgggg
gcgctgcgggacctgctcggcctgaccgtcgaggagttcctgccgctgcgctccggcgag
acgctgcgcctcggtccggccaccggggacgcctcggagaccggggccgccccgctgacc
ggggacgtctgggccgaggcggtgctgccgcacggggcggagccggtgctgcgctatctg
gacggtccggccgccggtggtcccgccgtcacccgacactccctcggcgccggccacgcc
tggtacgtctccacccggctggacgcggccgggctggccccggtgctccgggcggcgtac
cgggacgccggcctggtcccgccggacggggtgccggacggggtcgagctgctccggcgg
gcgggtgcggacgggagccggttcctgatcgctatcaaccacgccgaccgggacgcggag
ctgccggccaccggcaccgacctggtggacggcagcgtccacgatggagtgctccgggtg
ccggccggcggcgtacgggtgctgcgcaccggctga

DBGET integrated database retrieval system