KEGG   Plantactinospora sp. BC1: C6361_19370Help
Entry
C6361_19370       CDS       T05377                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:plab00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    C6361_19370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:plab03400]
    C6361_19370
Enzymes [BR:plab01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C6361_19370
DNA repair and recombination proteins [BR:plab03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C6361_19370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 DUF5415
Motif
Other DBs
NCBI-ProteinID: AVT34595
LinkDB All DBs
Position
4449380..4450333
Genome map
AA seq 317 aa AA seqDB search
MPGTPVKPMLAVTGELPAGPGWVHEFKWDGVRAVSDFAGDELRLYARSGVQITAAYPELA
PLGAQLAQRGLADAVLDGEVVVLTEQGQPSFTALAERMHVREPARAARLAVSLPVTYMIF
DLLRRDGTDLTGWPYQRRREALEALGLAGPRWAVPPVFPDGRATYQAAGEHGLEGVVSKR
VDAVYRAGIRSPDWVKVKLEVTDDFVVGGWRPGVRRIGGLLVGVPAPDGGLVYRGRVGGG
IGAAIERELLAVLEPLRSGTSPFVTPVPREDARGAIWVTPQIVVEVKYGQRTPDGRLRFP
RIRRLRTDKTVADVDGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcaccccggtcaagccgatgctcgcggtcaccggggagctgcccgcaggcccc
ggctgggtgcatgagttcaagtgggacggggtgcgggcggtctccgacttcgccggtgac
gagctgcggctctacgcgcgctccggggtgcagatcaccgccgcctatccggaactcgcc
ccgctgggcgcccagctcgcgcagcgggggctggccgacgcggtgctggacggcgaggtg
gtggtgctgaccgagcaggggcagccgtcgttcaccgcgctcgccgagcggatgcacgtg
cgggagccggcccgggccgcccggctggcggtgagcctcccggtgacgtacatgatcttc
gacctgctgcggcgggacgggacggacctgaccgggtggccgtaccagcgccgccgggag
gcgctggaggcgctcggcctggccgggccgcgctgggcggtaccgccggtcttcccggac
ggccgggccacctaccaggcggccggcgagcacgggctggagggcgtggtgtcgaaacgg
gtcgacgccgtctaccgggccgggatccggtcgccggactgggtgaaggtgaaactggag
gtcaccgacgacttcgtggtcggcggctggcggcccggcgtacgccggatcggtgggctg
ctggtcggggtgccggcgccggacggcggcctggtctaccggggccgggtcggcggcggc
atcggcgcggcgatcgagcgggaactgctggccgtactggagccgctgcgcagcggaacc
tcgcccttcgtgaccccggtaccccgggaggatgcccggggcgcgatctgggtaactccc
cagatcgtggtggaggtgaagtacggccagcgcacgccggacggtcgactgcggttcccg
cggatccgccggctgcgcaccgacaagacggtggcggacgtcgatggcgcgtga

DBGET integrated database retrieval system