KEGG   Plantactinospora sp. BC1: C6361_24070
Entry
C6361_24070       CDS       T05377                                 

Definition
(GenBank) erythromycin biosynthesis sensory transduction protein eryC1
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00523  Polyketide sugar unit biosynthesis
plab01100  Metabolic pathways
plab01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    C6361_24070
Enzymes [BR:plab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     C6361_24070
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Aminotran_1_2 Cys_Met_Meta_PP AMP-binding
Other DBs
NCBI-ProteinID: AVT32042
LinkDB
Position
5517413..5518513
AA seq 366 aa
MTVPFLDLRAAYAELRTELDAAYARVLASGRYVLGPETEAFEAEFAAFCGAPHCVTVGSG
CDALELALRALDIGDGDEVIVPSHTFIATWLAVSAAGARPVPVEPDERTGTMDPARIEAA
ITGRTRAIMPVHLYGHPADLDGINEVAASRGLAVLEDAAQAHGARYRGRRVGEGSTVAAF
SFYPGKNLGAMGDGGAVLTADAGLAERVRLLRNYGSRVKYQHELRGTNSRLDELQAAFLR
VKLAHLPEWNRRRAEVATRYLTDLAGLPGLTLPGVASWAEPVWHLFVVRTAARDRLRAAL
HRSGVETIIHYPVPPHLAPAYAGPDVPAGGYPVAERLADEVLSLPIGPHLSAEQVKTVVA
AVRAGL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgacggtgcccttcctggacctgcgcgccgcgtacgccgaactccgcaccgaactggac
gccgcctacgcccgggtgctggcctccgggcggtacgtgctcgggcccgagacggaggcg
ttcgaggccgagttcgccgccttctgcggcgcaccgcactgcgtcacggtgggcagcgga
tgcgacgcgctggaactggccctgcgggcactcgacatcggcgacggcgacgaggtcatc
gtgccgtcgcacaccttcatcgcgacctggttggcggtgtcggcggccggcgcccggccg
gtgccggtcgagccggacgagcggaccgggacgatggacccggcccggatcgaggccgcg
atcaccggtcggaccagggcgatcatgccggtacacctctacggccacccggccgacctg
gacgggatcaacgaggtggccgccagccggggcctggcggtgctggaggacgcagcccag
gcccacggcgcccggtaccgtggccgtcgggtgggcgagggttcgaccgtggcggcgttc
agcttctacccgggcaagaacctcggcgcgatgggcgacggcggagcggtgctgaccgcc
gacgccggcctggccgagcgggtacggctgctgcgcaactacggctcgcgggtcaagtac
cagcacgagttgcgcggtacgaactcgcggctcgacgaactccaggcggcgttcctgcgg
gtcaaactggcccacctgccggagtggaaccgccgtcgcgccgaggtggcaacgcggtac
ctgacagacctcgccgggctgcccggactgacactgcccggggtggcgtcctgggccgaa
ccggtgtggcacctcttcgtggtccggacggcggcccgggaccggctgcgggcggcactg
caccggtccggcgtggagacgatcatccactacccggtgccgccgcacctcgccccggcc
tatgccggccccgacgtcccggccggcggatacccggtcgccgaacgcctcgccgacgag
gtgctcagcctgccgatcggcccgcacctgtcggccgagcaggtcaagacggtggtcgcc
gccgtacgcgccggactgtga

DBGET integrated database retrieval system