KEGG   Candidatus Planktophila dulcis: A1s21155_00935Help
Entry
A1s21155_00935    CDS       T05051                                 

Definition
(GenBank) nickel superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
plak  Candidatus Planktophila dulcis
Brite
KEGG Orthology (KO) [BR:plak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A1s21155_00935
Enzymes [BR:plak01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A1s21155_00935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: ASY11577
UniProt: A0A249KBG5
LinkDB All DBs
Position
complement(191844..192242)
Genome map
AA seq 132 aa AA seqDB search
MRNILTPKITVHAHCDLPCGVYDPAQAKIEALSVKACMEKYAANPDADFRSRSVAIKEER
SHQVKEHLWVLWTDYFKAPHFEKYPQLHSLFNEATKLAGAAGTKGTQDVAVADSLIAKID
EIAAIFWETKKA
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgagaaacattcttacaccgaaaataactgtccacgcacactgcgatctaccttgcggt
gtctacgatccagcacaagcgaagattgaagcgctctctgttaaggcatgcatggaaaag
tatgcagctaacccagatgcagatttccgttcacgctctgttgcaattaaagaagagcgt
tcacatcaggttaaggagcacctctgggttctctggactgattacttcaaggcaccacac
tttgagaagtacccacagttgcactcactctttaacgaggcgacaaagcttgcaggtgct
gcaggcacaaagggaactcaagatgttgcagttgcagatagtttgatcgcaaagatcgac
gaaattgcagcaatcttctgggagaccaagaaggcttaa

DBGET integrated database retrieval system