KEGG   Candidatus Planktophila dulcis: A1s21155_01870Help
Entry
A1s21155_01870    CDS       T05051                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
plak  Candidatus Planktophila dulcis
Pathway
plak00564  Glycerophospholipid metabolism
plak01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A1s21155_01870
Enzymes [BR:plak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A1s21155_01870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 GMC_oxred_N GIDA Thi4 AlaDh_PNT_C Pyr_redox HTH_22 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ASY11740
LinkDB All DBs
Position
363405..365060
Genome map
AA seq 551 aa AA seqDB search
MFTSQLNPLQRQKALTSLASEEFDILIIGGGVNGVGAALDAVSRGLKVALVEAHDYAAGT
SSRSSKLIHGGLRYLEQYDFKLVREALHERELMVSTQCPHLVKPVSFLYPLTEKVKERTY
VGAGLALYDALRGFKRALPSHKHLTGKTIANISPSLRQDIITGAIRYFDAQVDDARHTMM
IARTAARHGAVMATGVRVDDLTRSGKKVIGVVAIDTATNKKFTISAKATIMCAGVWSDEL
HEKFGLTPGYSVAMSKGVHIVVPGDAIHSKDGIILKTPVSVLFLIPWADKWIVGTTDTPY
EGDRSKPLATQEDVQYILDQANRVLDPQLNAEDIIGVFAGLRPLVANKTGSATTKLSREH
TVDRPAPGFVSIAGGKYTTYRVMAKDAVDLAVLDLRRLVNDSVTEKLPLIGADGYFALKQ
QVAKIAEENAISEATVTHLLDRYGSLIEEILELIAQDSSLSERIIPELPYLKAEILHAVT
HEGALSVEDVLLRRTRISFEAFDGGADAAKEVAKIIGDALGWGAKERNASVSDFLAVIEK
EEEALVELINS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgtttacttcacagctcaatccactgcaacgccagaaggctcttacctctctggccagt
gaagagttcgacatcctcattatcggtggcggagtcaacggagtaggtgcagcccttgat
gctgtttctcgtggattaaaggtcgccctcgttgaagcccatgattatgcagccggaact
tcaagtcgatccagcaaacttattcacggtggccttcgataccttgagcaatatgatttc
aaattagtacgcgaggctctgcatgagcgcgaactcatggtttcaacacaatgtccgcac
ttagtaaagccggtcagttttctctatccattgacggaaaaagtaaaagagcgcacatat
gtaggtgcaggacttgctctctatgacgcacttcgtggatttaagcgcgcacttccttct
cacaagcatttaacgggtaagacaattgcaaatatctcaccatcactgagacaagacatt
attactggtgctattcgttacttcgatgcacaggtagacgatgctcgccacacgatgatg
attgctcgaacggcagctcggcacggcgcagtcatggcaacaggtgtgcgcgttgatgac
ctgactcgctctggcaagaaagtaataggcgttgttgcaatcgatactgcaactaataag
aaattcaccatctctgcaaaggcaacaatcatgtgtgctggtgtgtggagcgatgaactc
cacgagaagtttggtctcacacctggttattcagtagcaatgtctaagggtgttcatatc
gttgttccaggagatgccatccactccaaagatggaattattctgaagaccccagtctct
gtgctctttcttatcccttgggcagataagtggattgttggaaccacagatactccctat
gaaggagatcgctctaagccgcttgccacacaagaagatgtgcaatacatccttgatcag
gcaaaccgagtgctcgatccgcaactgaacgctgaagacatcatcggagtatttgcaggt
cttcgcccattggttgcgaataagactggctctgcaacaacaaaactttcccgtgaacat
acagtcgatcgaccagcacctggctttgtcagtattgctggtggtaaatacaccacctat
cgcgtgatggctaaagatgccgttgatcttgccgtgcttgatcttcgtcgactagtcaat
gattcagtcactgagaaacttcctcttattggcgcagatggctactttgcacttaagcaa
caggttgccaagattgcagaagagaatgcaatctctgaggcaactgtgacccaccttctt
gatcgctacggctcactgattgaagagattcttgaacttattgcgcaagattcatctctt
tctgaacgcatcattcctgaacttccttatctcaaggcagagattcttcatgctgtcacc
catgaaggtgcgctctcagttgaagatgttctccttcgtcgcacgcgcatctcatttgaa
gccttcgatggtggcgcagatgcagcgaaagaggtggcaaagattattggtgatgcactt
ggatggggcgcgaaagaacgtaacgcttcagttagcgacttccttgctgtgatagagaaa
gaagaagaagctctcgttgagctgattaattcttaa

DBGET integrated database retrieval system