KEGG   Candidatus Planktophila dulcis: A1s21155_06765Help
Entry
A1s21155_06765    CDS       T05051                                 

Definition
(GenBank) eukaryotic-like serine/threonine-protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
plak  Candidatus Planktophila dulcis
Brite
KEGG Orthology (KO) [BR:plak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:plak01001]
    A1s21155_06765
Enzymes [BR:plak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     A1s21155_06765
Protein kinases [BR:plak01001]
 Serine/threonine kinases: Other
  Bacterial family
   A1s21155_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal RIO1 Seadorna_VP7 Haspin_kinase
Motif
Other DBs
NCBI-ProteinID: ASY12615
LinkDB All DBs
Position
1305200..1306747
Genome map
AA seq 515 aa AA seqDB search
MMNSLLGGRYLLGQMIGTGGMADVYIAQDQRLSREVAIKILRSDLAKDPAFVSRFRKEAK
AAAGLNHPGIVAVYDSGEEPAPYIVMELVSGHTLRELIHQGERLPLNRALEITEGILAGL
EYSHERQIVHRDIKPANVMITDNGDVKVMDFGIARAMDDLGATLTSTWNVVGTAQYLSPE
QAVGESADSRSDIYSTGCLLFELLTGEPPFTGETPVSIAYQHASSTAPLVRTLKSELPEG
IEIVLAVALSKKPEDRYQSAQAMLDDIAKVRAGEEVTTKIATEPFMTRRRAIIFGGSFFA
AIALSITGLLMSGGGANSGPMVPNVVGLSEEMARALLTDYSVTIKRAHDGVIPRDRVASQ
LPLATTRAQIGSAVVLTISDGPGDAIVPDNLVGMSLIDARSALTSVGLLVSQTIASPSDQ
PQGTVLDVMPAVGSVTEAGSSVILTIASGEVTVPNLIGIEAIQAKTLLIQAGFLIKEFYD
YDSAQPAGVVIRQAPEAATTQTIGKSVTITINRAP
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatgaactcattgctcggcggtcgctatctactcggtcagatgattggcacaggcgga
atggcagatgtttatatcgcccaagatcaacgtctctcacgtgaagttgctatcaagatt
ctccgtagtgatttagcaaaagatccagcatttgtttcgcgctttcgcaaagaggcaaaa
gctgctgctggtcttaaccatcccggcatcgttgctgtctatgactctggtgaagaacct
gctccttatattgtgatggagcttgtctcaggccacacgctgcgcgaacttattcatcaa
ggtgagcgccttccactgaatcgcgcgctggagataacagaaggaattcttgcagggctt
gaatattcacatgagcgccagatagttcaccgcgatatcaaacctgcaaacgtcatgatt
accgataacggtgatgtgaaggtgatggactttggaattgctcgcgcaatggatgacctc
ggtgcaacactaaccagcacatggaatgttgttggaactgcgcaatatctctcacctgaa
caagctgtgggagaatctgctgattcacgtagtgatatctactcaacgggatgtttactc
tttgaattactgacaggtgaaccaccatttactggagagacacctgtatcgatcgcatac
caacatgcatccagtactgccccactagtgcgcaccttaaaatctgaattgcctgaaggt
attgaaattgttctcgctgttgcactctctaagaaacctgaagatcgctatcaaagtgca
caagcaatgctcgatgacattgcaaaggtgcgtgctggtgaagaggtaacaaccaagatt
gcaacagagccatttatgactcgacgccgcgccatcatctttggcggttcattctttgcc
gcaatcgccctatcaatcacaggcttactgatgagcggtggcggtgcaaattcagggcct
atggttccaaacgttgtgggattaagtgaagagatggcacgtgctctccttactgattat
tcagtaacaattaagcgtgcccacgatggtgtgattccaagagatcgcgttgctagccaa
ttaccgcttgcgacaacacgagcacagattggttcagctgttgtccttactatctctgac
ggaccaggagatgccatcgttcctgacaatctcgttggtatgtcacttattgatgcgcga
tctgcgctcacatcagttggtcttcttgtctctcaaacaattgcctcgccttcagatcaa
cctcaaggaactgttcttgatgtcatgcctgcagtgggatcagttactgaggcaggtagt
tctgtcattctcaccatcgcaagtggtgaggtaacagttccgaacttgatcggtatcgaa
gcaattcaagccaagactctactcattcaagcaggctttttaattaaagaattttatgat
tacgactcagcacaaccagctggagttgttatccgacaggcaccagaggctgcgacaacg
cagacaattggtaagtcagtaactattacgattaacagagctccatag

DBGET integrated database retrieval system