KEGG   Candidatus Planktophila lacus: A1s21148_00810Help
Entry
A1s21148_00810    CDS       T05050                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
plan  Candidatus Planktophila lacus
Pathway
plan00620  Pyruvate metabolism
plan00680  Methane metabolism
plan01100  Metabolic pathways
plan01120  Microbial metabolism in diverse environments
plan01200  Carbon metabolism
Module
plan_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:plan00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    A1s21148_00810
  Energy metabolism
   00680 Methane metabolism
    A1s21148_00810
Enzymes [BR:plan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     A1s21148_00810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: ASY10120
LinkDB All DBs
Position
complement(166119..168845)
Genome map
AA seq 908 aa AA seqDB search
MPVTQSPANANNIASDDAILRSDVRKLGDLLGQSLVRQEGQELLDLVESVRKAVREGGGI
ELLEKLSVEDSVQLVRAFSTYFHLANVAEQVHRARVLAQSRAVGGSWLSRAIDKIEEAYK
AQTPGHSFTHADLEQWVSELMVRPVFTAHPTEAARRSILNKLGEVAKLLDQDLNPRQNER
LAETVDLLWQTDELRLNRPEPLDEAMNALYYLDDLALNTVPEVLNDFARELKRLDIDLPV
TARPLTFGTWIGGDRDGNPNITAQVTEDAIALQVAHAIRTSISAMDELRQMLSISTRIVG
TTPELQASIEEDLKNIPEFEPRFLRLNQQEPYRLKATAIAHRLIFTRNRHASQAPHVPGR
DYANSAELIADLTLMRDSLAAHRGELIATGFLERTIRSIAAFGLTHATLDVREHSDAHHN
LLKQVMPAGYIDLSHNEKFPVLISELAKKSPLDLTTLDAAGKKTFDTFKAIDDLIARFGP
EVIETYIISMTKGADDLVAAAVIGKAAGLVDLDKKIAKIGFAPLLETVAELRAAGEILEK
LLSDPTYRSLVGLRDDVQEVMLGYSDSNKDAGIATSQWEIHRAQRALRDVAMKYGVKLRL
FHGRGGSVGRGGGPTYDALVALPWGSVDGQIKMTEQGEVISDKYALPALARENVELTLAA
SLEATILNRAARQSPADLAQWNECMNLISDNSFARYRKLIDHPDLPAYFYASTPVEQLGN
LFLGSRPSRRPDAAGGLDSLRAIPWVFGWTQSRQIVPGWFGVGTGLKAAREAGKSDVLKK
MLKEWHFFHTFISNVEMTLAKTDLVTAKRYVETLVPTELHHFLDTITEEFELTVKEILAL
TEKETLLGDQPILARTLQVRDAYLSPLHLLQVNLLHRVRTAGEAPDAMLVRALLLTINGV
AAGLRNTG
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgacgcagagccccgctaacgccaacaacatcgcaagcgatgatgcaattttg
cgtagcgatgtacgcaagcttggcgatcttctaggtcaatcacttgttcgccaagaagga
caagagcttctcgatctcgtggaatctgtgcgtaaagcggtccgcgaaggcggcggtatt
gaattactagaaaaactctccgtcgaagattctgtgcaattggtgcgcgcctttagtact
tacttccatttagcaaatgttgcagaacaagttcaccgcgcacgtgttcttgcgcaatct
cgcgcagtaggtggctcttggctaagccgcgcaatcgataaaattgaagaggcctataaa
gcacaaactccgggccattcctttactcacgcagatttagaacaatgggttagcgaactt
atggttcgccccgtatttaccgcacacccaaccgaagctgcgcgccgttcgatcctaaat
aaactcggtgaagttgcaaagttgttagaccaagatttaaatccgcgccagaacgagcgc
ttggcagaaactgtagatctcctttggcagaccgatgaacttcgtttaaatcgtccagaa
cctctggatgaagcgatgaacgctctttattacttagatgatcttgctttaaataccgtt
ccagaagttttaaatgattttgcgcgcgaactaaagcgccttgatatcgatctgccagta
actgcccgtccacttaccttcggtacctggatcggtggcgatcgcgacggtaatccaaat
atcactgcgcaagttactgaagatgcgattgcgctccaagttgcccacgcgatccgcact
tcgatttcagcgatggatgagctgcgtcagatgctctctatttcgactcgcatagttggt
acaactcctgaattacaagcctctattgaagaagatctaaagaatattccagagtttgag
ccacgcttcctacgtttaaatcagcaggagccgtatcgcttaaaggcaactgctatcgcg
caccgacttatatttacacgcaatcgccatgcatctcaggctccacatgttccagggcga
gactatgcaaattctgcagaactaatcgcagatttaactttgatgcgcgattcattggct
gcccatcgtggcgagctaatcgcaaccggctttctagagcgcacaatccgcagtatcgcc
gccttcggtcttacccatgcaactctcgatgttcgcgaacattctgatgcccaccacaac
cttttaaagcaagtaatgcctgcgggttacattgacctgtcacataatgaaaagtttccg
gtacttatttcagagttagcgaagaagagtccactagatctaacgactttagatgcagcc
ggaaagaagactttcgatacctttaaagcaattgatgatctaatcgcaagatttggccct
gaggtaatcgagacttacatcatctcaatgacaaagggtgcggatgatctagttgccgca
gcggtaattggtaaggctgccggtttagtcgatctcgataagaagatcgccaagatcggt
tttgcaccactgcttgaaacagttgcagaacttcgtgctgctggggaaattctagaaaaa
ctcctttctgatccaacttatcgctcgctcgttgggctgcgcgatgatgtgcaagaagtg
atgttgggatattcagattcaaataaagatgcaggtattgcaacaagtcagtgggagatc
caccgtgcacaacgtgcgcttcgtgatgtcgcgatgaagtacggtgtgaaacttcgtctc
ttccatggtcgcggtggttctgtgggtcgcggcggcggaccaacttacgatgctttggtt
gcacttccatggggctcagttgatggacagatcaagatgactgaacaaggcgaagttatt
agcgacaagtacgcacttccagctcttgctcgcgagaatgttgagttaacacttgccgca
tctcttgaggcaacgattcttaaccgcgcggctcgtcaaagcccagcagatttagcgcag
tggaatgaatgcatgaacttgatcagcgataactcttttgcgcgctaccgaaagttgatt
gatcacccagatcttcctgcttacttctatgcctcaacaccggtagaacaacttggaaat
ctcttcttaggttcacgtccatcgcgtcgcccagatgcagcaggcgggcttgattcactg
cgtgcgattccgtgggtatttggttggacccaatcacgacagatcgtgccgggttggttc
ggcgttggtactggactaaaggctgcgcgcgaggctggtaaatcagatgtcttgaagaag
atgcttaaggaatggcacttcttccataccttcattagtaatgtggagatgactttagct
aagacagatttagtaactgcaaaacgctatgtagaaactctggttcctaccgagcttcat
cacttcctcgacacaattactgaggaatttgagttaacggttaaagagatccttgctctt
actgagaaagagacgctgctgggagatcaaccaattctggctcgtaccttgcaggtgcgc
gatgcatatctttctccactgcatttgctccaagtaaacctcttgcaccgtgtgcgcact
gctggagaagcgccagatgcgatgttggttcgcgctctactgctgactattaacggtgtt
gccgctggccttcgtaatactggctga

DBGET integrated database retrieval system