KEGG   Candidatus Planktophila lacus: A1s21148_04820Help
Entry
A1s21148_04820    CDS       T05050                                 

Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
plan  Candidatus Planktophila lacus
Pathway
plan00970  Aminoacyl-tRNA biosynthesis
plan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plan00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A1s21148_04820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:plan03029]
    A1s21148_04820
Enzymes [BR:plan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     A1s21148_04820
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     A1s21148_04820
Mitochondrial biogenesis [BR:plan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A1s21148_04820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ASY10830
LinkDB All DBs
Position
complement(963959..965467)
Genome map
AA seq 502 aa AA seqDB search
MALTYDDVISKYEPVLGLEVHVELNTESKMFCSCSTTFGAEPNTQTCPVCLALPGALPVV
NATAIESTIKIGLALNCQIAPYSRFARKNYFYPDMPKNFQISQYDEPICFDGYVDVEIET
EEGPKQFRIEIERVHMEEDTGKSLHVGGATGRIHGAEYSLLDYNRAGIPLVEIVTKIVPG
TGKYAPEVAKAYVAELRDILRGLKVSDVKMEQGSLRCDANVSLRIIGSEVLGTRSETKNV
NSLRSVERAIRGEMIRHAELLNDGKKVKQETRHFQEESGLTRSGRSKEQAEDYRYFPEPD
LVPVAPDAGWIETLRKQLPERPSLRRKRLKEEWSVPDKEMAAMINADVLDIVEATVLLGA
EPTKARTWWLGEISRIANEKDSAIQDLSITPADVAEIVALVAAGELTDKLARQVVEGVIA
GEGKPSEVVAKRGIKVVNDDGALMAAIEKVCAEQAETADKVRNGHVPAAGALIGAVMKET
KGQADAARVRELLLGHLGQPTN
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttacctatgacgatgtaatttcaaagtacgaacctgtacttggcctagaagtt
cacgttgaactaaataccgagtccaagatgttctgctcttgcagcaccactttcggtgca
gagccgaacactcaaacgtgcccagtctgcttggcgctacctggcgcgctaccagttgta
aatgccacagcgatcgaatcaactatcaaaattggtttggcgcttaactgtcagatcgcg
ccttacagccgctttgcacgtaagaactatttctatcccgatatgccaaagaacttccag
atttcgcagtacgacgaaccaatctgtttcgatggatatgtcgatgtagaaatcgaaact
gaagaaggtccaaagcagttccgcatcgaaattgaacgcgtacacatggaagaagacacc
ggaaagtcgctccacgttggcggcgcaactggtcgtatccatggcgcggaatattcactc
cttgattacaaccgcgccggaattccacttgttgaaatcgttaccaagattgttcctggc
accggcaagtacgcgccagaagttgctaaggcatacgttgccgaactccgtgacatcttg
cgcggcttaaaggtttcggatgtaaagatggagcaaggctcacttcgttgtgatgccaac
gtttcccttcgcataatcggttctgaagttcttggaacgcgctctgaaaccaagaacgta
aactctctacgctctgtcgagcgcgctatccgcggtgaaatgattcgtcacgctgaactg
ctaaatgatggcaagaaagttaagcaagagacgcgtcacttccaagaagagtcggggcta
actcgctctggtcgctcaaaagaacaagccgaggattaccgttacttccctgagccggat
ctagttccagttgcacctgatgcaggctggatcgaaactcttcgcaagcaattaccggag
cgcccatcgctacgtcgtaagcgcttgaaagaggaatggtctgttccagataaagagatg
gccgcgatgatcaacgctgacgttttggatatcgtggaagctaccgttctgcttggtgca
gaaccaactaaggcgcgtacttggtggctcggtgaaatctcacgtatcgcaaacgaaaaa
gattctgcgattcaagatctctcaatcacacctgctgatgttgctgaaatcgttgcgcta
gttgctgcaggcgagctcaccgataagttggcccgccaagttgtagaaggcgtaatcgct
ggtgaaggaaagccttctgaagttgtggcaaagcgcggtattaaagttgttaacgatgat
ggcgcgctaatggcagccattgagaaggtttgtgctgagcaagcagagactgcagataaa
gtccgtaatggacatgttcctgcagcgggtgctttgatcggtgcagtaatgaaagagaca
aagggccaagcagatgctgctcgcgtacgagagcttctacttggccacttaggtcagcca
actaattaa

DBGET integrated database retrieval system