KEGG   Candidatus Planktophila lacus: A1s21148_07170Help
Entry
A1s21148_07170    CDS       T05050                                 

Definition
(GenBank) xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
plan  Candidatus Planktophila lacus
Pathway
plan00040  Pentose and glucuronate interconversions
plan00051  Fructose and mannose metabolism
plan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A1s21148_07170
   00051 Fructose and mannose metabolism
    A1s21148_07170
Enzymes [BR:plan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     A1s21148_07170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: ASY11405
LinkDB All DBs
Position
complement(1412360..1413352)
Genome map
AA seq 330 aa AA seqDB search
MGKLTYGAGIWAFGQFVDRYAGDGYGPTRTSQQMIEDAAKVPGLKHLDINVPFDIPERTA
VEIKKMLDDNGLICRATTPHIYMREYVKGSFTNPDTKLRSQTKDRVREAIAAAEILGATY
VKFWPGQDGFDFPLQANYLQIWDYTINGIRDLANENPKVQFAIEYKCKEPRVRMTLATAA
KTLLAISEMKVDNVGIVMDFGHSLMAQETPAESLLLIHRHGKLVSAELNDNWRGWDDDLP
VASVHLFETIEYMLALRSINWTDPVLLDQFPFREDPVRALTRSIEIITYLEEVCDRVDIA
ALNQAQNSQDALAAQAVIWDALMQEKRFTR
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaactaacttacggagcaggcatctgggcctttggccaatttgttgatcgctat
gccggagacggttacggaccaacgcgcaccagccagcagatgattgaggatgccgccaag
gtccctggccttaagcacctagatataaatgtgccatttgatattccagagcgcaccgca
gttgagatcaagaagatgcttgatgacaacggacttatctgccgtgcgacaactccacat
atttacatgcgcgaatatgtaaagggttcatttaccaacccagataccaagcttcgttca
caaactaaagatcgcgttcgagaggcaattgctgctgccgaaatccttggagcgacttac
gtaaaattctggccgggccaagatggttttgatttcccacttcaagcaaattacttacag
atctgggattacaccatcaacggtattcgcgatctggcaaatgaaaaccctaaggtgcag
tttgcgattgaatataaatgcaaagaaccgcgcgtacgaatgacacttgcaaccgcggca
aaaactcttcttgcaatcagcgagatgaaagttgataacgtcggaatcgtgatggacttc
ggccactcgcttatggcgcaagagactccagctgaatcacttcttcttatccaccgccat
ggcaagttagttagcgctgagctaaacgataactggcgcggctgggatgatgatctacct
gttgcatctgtgcatttatttgaaaccatcgaatatatgttggcgcttcgcagcatcaat
tggactgatccagtattacttgatcaattcccattccgcgaagatccagtgcgcgcacta
actcgcagcatcgaaatcattacctaccttgaagaagtctgcgatcgcgtagatatcgca
gccctcaatcaggctcagaactcgcaagatgcgctggccgcacaggcggttatctgggat
gccttgatgcaagagaagcgtttcacgcggtag

DBGET integrated database retrieval system