KEGG   Plantibacter sp. PA-3-X8: EAO79_00500Help
Entry
EAO79_00500       CDS       T05731                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
plap  Plantibacter sp. PA-3-X8
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo
Motif
Other DBs
NCBI-ProteinID: AZH81541
UniProt: A0A3G8V637
LinkDB All DBs
Position
complement(104690..105997)
Genome map
AA seq 435 aa AA seqDB search
MGAPRSRRLGPGSPALSMVLVAVRGPQGSIGVLQTPTRCASRSQHSDTNPPERRTPCNVV
AGTACREHGGAANIDCTVKGAAVSDSLHRPPAHAGSITDPAAMFTEHTETVVTGVSLSNG
RYSIGEQLGSGGSANVYRARDELLSRPVAVKLFRDEAATANDRLRQEREIRLLGELRHPG
LVELYDSGSVVHRGVEHRFLVMEYIPGATLTDKLQAGPMLPRDAAALGAQVADALSFIHT
RSIVHRDIKPDNMLFSDIAAFGHANLVKLSDFGIAHFVGGSRLTNTEAISGTASYLSPEQ
ALGDTVGTETDIYSLGLVLLEAVTGRREFDGGLVEAAIARLHRDPVIPPELPAAWHPLLR
SMTARKPEDRPAAHEVAASLREIWSESRVRRVRRVRARLGLVVDQGVDPRIALLLAAATA
AAGLAIGVAIGIFAF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctcctcgcagcagacgactcggcccgggttccccggccctctccatggtcctc
gtcgcggttcggggcccgcaagggagcatcggggtcttgcagacgcctaccaggtgcgct
agccgttctcaacactccgacacgaatccgcctgaacgacgaacgccttgtaacgtggtt
gctggaacagcctgccgagaacacggtggcgcggccaacatcgactgcaccgtgaagggg
gcggccgtgagcgactccctgcaccgaccgccggcacacgccggatcgatcaccgatcca
gctgcgatgttcaccgagcacaccgagacggtcgtcaccggcgtcagcctgtcgaacggg
cgttacagcatcggtgagcagctcggctccggcgggtccgccaacgtctaccgcgcacgc
gacgagctgctctcgcgccccgtcgccgtgaagctcttccgcgacgaggccgcgaccgcg
aacgaccggctgcgtcaggagcgggagatccgtctgctcggggaactccgccacccgggg
ctcgtcgagctctacgactccggttccgtcgtccaccgcggcgtcgagcaccggttcctc
gtcatggagtacatcccgggcgccacgctcaccgacaagctgcaggccggcccgatgctc
ccgcgtgacgcagccgccctcggtgcgcaggtcgccgacgcgctgtccttcatccacacg
cggtcgatcgtgcaccgcgacatcaagcccgacaacatgctcttcagcgacatcgccgcg
ttcggccacgcgaacctcgtgaagctgtccgacttcgggatcgcgcacttcgtgggcggg
tcgcgcctcacgaacaccgaggccatctccggcacggcgtcctacctctcgcccgagcag
gcgctcggcgacaccgtcggcaccgagacggacatctactcgctcggcctcgtcctgctc
gaggccgtcaccggtcgccgggagttcgacggcggtctcgtcgaggccgccatcgcacgc
ctgcaccgtgacccggtgatcccgcccgagctccccgccgcctggcacccgctgttgcgg
tccatgaccgcccgcaagccggaggaccgacccgccgcccacgaggtcgcagccagcctg
cgcgagatctggtccgagtcgcgcgtccgccgggtccgccgggtgcgtgcgcgcctcggt
ctcgtcgtcgaccagggcgtcgacccccggatcgcattgctcctcgccgccgcgacggcc
gctgcggggctcgccatcggcgtcgcgatcggcatcttcgcgttctga

DBGET integrated database retrieval system