KEGG   Plantibacter sp. PA-3-X8: EAO79_03940Help
Entry
EAO79_03940       CDS       T05731                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    EAO79_03940
Enzymes [BR:plap01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EAO79_03940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C DUF4434 Glyco_hydro_14 Glyco_hydro_35
Motif
Other DBs
NCBI-ProteinID: AZH82142
UniProt: A0A3G8VB46
LinkDB All DBs
Position
823498..825507
Genome map
AA seq 669 aa AA seqDB search
MSTTPTFSHDGIAYGCDYNPEQWDRSVWREDVALMQEAGVDLVALNIFGWSHLEPRPGEF
DFAGLDEILDLLHEAGIRVNLGTGTASAPPWLTFRHPEILPETEDGTTRFPGGRQAWCPS
SAVFRRYALELVERVAVRYGAHPAVELWHVSNELGCHNALCYDDESAEAFRGWLRARYET
IERLNTAWGTSFWSQQYSDFAEILPPRLTLSSRNPSQVIDFHRFSSDELLGYYRAELEVL
RRHSSVPVTTNFMVTAHIRNLDYWQWAPEMDVVANDHYLDNRLADPTAELAFASDLTRGL
ASGGAWLLMEQSTGAVNWQPQNLAKAPGEMTRNSLTHVAKGAEAICFFQWRASLQGSEKF
HSALLPHAGTDSDVWREVVELGGTLDRLDEITGTRVQADVALLFSWENWWAADGESRPTH
AIDHLSQVHAVHASLRRLGHTVDVVRPGADLSAYRLVVVPNLYLVRDSEAAVVSDFVAAG
GHAVVTFFSGIADEEDRVRPGGYPGAFRELLGVNVEEFAPVLPGQVLTLASGRSATAWSE
RTRARGAEVVDSFADGPSTGRPAITRNRIAGGGDAWYLATNLDAGALDEVLRDAAAGAGA
LPQGDPDQPGLEVVRRADEGRSYLFLINHSTNDVELPARGRELVTGEPVDSIARVPAGAV
RVIREDRTR
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgacccccacgttcagccacgacggcatcgcctacggctgcgactacaacccc
gagcagtgggatcggtccgtctggcgcgaagatgtcgcgctcatgcaggaggcgggcgtc
gacctcgtcgccctcaacatcttcggctggtcgcacctcgagccacggccgggggagttc
gacttcgccgggctcgacgagatcctcgacctgctccacgaggccggtatccgggtcaac
ctcgggaccggcaccgcatcggccccaccgtggctgacgttccggcacccggagatcctc
cccgagaccgaggacgggacgacgcgcttccccggcggtcgccaggcctggtgtccgtcg
tccgcggtcttccgtcgctacgccctcgaactcgtcgagcgcgtcgccgtccgttacggc
gcgcaccccgccgtcgagctctggcacgtgtcgaacgaactcggctgccacaacgcgctc
tgctacgacgacgagagtgccgaggccttccggggctggctccgcgcccgctacgagacg
atcgagcgtctgaacaccgcgtggggcacgtcgttctggagtcagcagtacagcgacttc
gccgagatcctgccgccgcgcctgaccctgtcgagccggaacccgagccaggtcatcgac
ttccaccgcttctcctccgacgagctcctcggctactaccgggccgagctcgaggtcctg
cgccgccacagctccgtacccgtcacgaccaacttcatggtcaccgcgcacatccggaac
ctcgactactggcagtgggcgcccgagatggacgtcgtcgccaacgaccactacctcgac
aaccgcctcgcggaccccacggccgaactcgcgttcgcaagcgacctcacgcgcggtctc
gcgagtggcggtgcgtggttgctcatggagcagtccaccggtgcggtcaactggcagccg
cagaacctcgcgaaagcaccgggcgagatgacccggaactccctcacgcacgtcgcgaag
ggcgcggaggcgatctgcttcttccagtggcgtgcgtcgctgcagggctcggagaagttc
cactcggccctgctgccgcacgcgggcaccgactccgacgtgtggcgcgaggtcgtcgag
ctgggtggcacgctcgaccgactcgacgagatcaccggcacgcgcgtccaggccgatgtc
gccctcctcttctcctgggagaactggtgggccgccgacggcgagagccgcccgacccac
gcgatcgaccacctctcgcaggtccacgcggtccacgcgtcgctgcgtcgtctgggtcac
accgtcgacgtcgtgcgtccgggcgccgacctctccgcctaccggctcgtcgtcgtcccg
aacctgtacctggtgcgcgacagcgaggccgcggtcgtctcggacttcgtcgcagccggt
gggcacgccgtcgtcaccttcttcagcgggatcgccgacgaggaggaccgggtccgcccc
ggcggctaccccggtgcgttccgcgagctgctcggcgtcaacgtcgaggagttcgccccc
gtcctccccggccaggtgctgacgctcgcgtcgggccggagcgcgacagcatggtccgag
cggactcgcgcccgaggagccgaggtcgtcgactccttcgccgacggcccgtcgaccggt
cgcccggccatcacgcgcaaccgcatcgcgggcggcggcgacgcctggtacctcgcgacg
aacctggacgccggcgcactcgacgaggtgctccgcgacgcagccgcgggggccggggcg
ctgccacagggtgatccggaccagccgggcctcgaggtcgtccgccgcgccgatgaggga
cggagctacctcttcctcatcaaccactcgacgaacgacgtcgagctgccggcccgcggg
cgcgagctcgtcaccggcgaacccgtcgactccatcgcacgcgtgccagccggcgccgtg
cgcgtcatcagagaggaccgcacgcgatga

DBGET integrated database retrieval system