KEGG   Plantibacter sp. PA-3-X8: EAO79_08110Help
Entry
EAO79_08110       CDS       T05731                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00250  Alanine, aspartate and glutamate metabolism
plap00280  Valine, leucine and isoleucine degradation
plap00310  Lysine degradation
plap00410  beta-Alanine metabolism
plap00640  Propanoate metabolism
plap00650  Butanoate metabolism
plap01100  Metabolic pathways
plap01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EAO79_08110 (gabT)
   00650 Butanoate metabolism
    EAO79_08110 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAO79_08110 (gabT)
   00280 Valine, leucine and isoleucine degradation
    EAO79_08110 (gabT)
   00310 Lysine degradation
    EAO79_08110 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAO79_08110 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plap01007]
    EAO79_08110 (gabT)
Enzymes [BR:plap01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EAO79_08110 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     EAO79_08110 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     EAO79_08110 (gabT)
Amino acid related enzymes [BR:plap01007]
 Aminotransferase (transaminase)
  Class III
   EAO79_08110 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZH82862
UniProt: A0A3G8VD26
LinkDB All DBs
Position
complement(1683780..1685144)
Genome map
AA seq 454 aa AA seqDB search
MTSSTAAPAPSILGGPSLPQERRLVTAIPGPISEELMARKHAAVASGVGTTMPVFAAGAG
GGVLVDVDGNSLIDLGSGIAVTGVGNSNPRVVEAVTRQLQEFTHTCFTITPYDSYVEVAE
ALNRLTPGDHAKRTALFNSGAEAVENAVKIARSHTKKQAVVAFDHAYHGRTNLTMALTAK
SMPYKSGFGPFASEVYRAPLSYPFRDGGLTGAEAAQRAITQIEKQIGADNLAAIIIEPIQ
GEGGFIVPADGFLPALLDWARANDVVFIADEVQTGFARTGAMFASEHFDIVPDLIITAKG
IAGGLPLSAVTGRAEIMDAPHAGGLGGTYGGNPLACVAALAAIEAYEEEDLAASARAIET
RIVDRFTAAQASDPRIGDIRGRGAMMAVEFVDPATGEPDAALTARVAKAAHQAGVVVLTC
GTYGNVVRFLPPLTIPLELLDEGLDVVLEALAAN
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcagcaccgcagcccccgcgccctccatcctcggcggaccctcgctcccccag
gaacgtcgcctcgtcaccgccatccccggaccgatctccgaggaactcatggcgcggaag
cacgccgcggtcgcgtccggcgtcggcaccacgatgccggtgttcgcggccggcgcgggc
ggtggcgtcctcgtcgacgtcgacggcaactccctgatcgacctcgggtccggcatcgcc
gtgaccggtgtgggcaacagcaacccgcgcgtcgtcgaggccgtcacccgacagctgcag
gagttcacccacacctgcttcaccatcaccccctacgactcctacgtcgaggtcgccgag
gcgctcaaccgcctcacccccggcgaccacgccaagcggacggcactgttcaactcgggc
gccgaagcggtcgagaacgcggtgaagatcgcccgcagccacacgaagaagcaggcggtc
gtcgccttcgaccacgcgtaccacggccgcacgaacctgacgatggccctcaccgcgaag
tccatgccctacaagagcggcttcggccccttcgcctccgaggtgtaccgcgcgccattg
tcctaccccttccgtgacggcgggctcaccggcgccgaggcggcgcagcgcgcgatcacc
cagatcgagaagcagatcggcgcagacaacctcgcggcgatcatcatcgagcccatccag
ggcgagggcggcttcatcgtcccggcggacggcttcctgccggccctgctcgactgggcc
cgcgcgaacgacgtcgtcttcatcgccgacgaggtccagaccggcttcgcccgcacaggt
gcgatgttcgcgtccgagcacttcgacatcgtgcccgacctcatcatcaccgccaagggc
atcgcgggcggcctgccactctccgccgtcaccggacgcgcggagatcatggacgccccg
cacgccggcggcctcggcggcacctacggcggcaacccactcgcctgtgtcgctgccctt
gcggcgatcgaagcgtacgaggaggaggacctcgcagcctcggcccgggcgatcgaaacc
cgtatcgtcgaccgcttcaccgcggcacaggcctccgacccccgcatcggtgacatccgc
gggcgcggcgccatgatggcggtcgagttcgtcgacccggccaccggcgagcccgacgcc
gccctcacagcacgcgtcgcgaaggccgcccaccaggccggggtcgtcgtcctcacctgc
ggcacctacggcaacgtggtccgcttcctcccgccgctgaccatccccctcgagctgctc
gacgaaggactcgacgtcgtcctcgaggcgctcgccgcgaactga

DBGET integrated database retrieval system