KEGG   Plantibacter sp. PA-3-X8: EAO79_11800Help
Entry
EAO79_11800       CDS       T05731                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00473  D-Alanine metabolism
plap00550  Peptidoglycan biosynthesis
plap01100  Metabolic pathways
plap01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EAO79_11800
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EAO79_11800
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EAO79_11800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:plap01011]
    EAO79_11800
Enzymes [BR:plap01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EAO79_11800
Peptidoglycan biosynthesis and degradation proteins [BR:plap01011]
 Precursor biosynthesis
  Amino acid ligase
   EAO79_11800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: AZH83509
UniProt: A0A3G8VBB7
LinkDB All DBs
Position
2477870..2478961
Genome map
AA seq 363 aa AA seqDB search
MTHKTGVVVLFGGRSSEHSISCATAGGVLAAIDRERYDVYPVGIARDGSYVLEVDDPSRY
ALDPAHLPEVDPSRPAMRWPERVGSRELTVVGEDGVPFTLGPIDIVFPILHGRFGEDGTV
QGMLELVDLPYVGSGVLASSLGMDKHFTKTVLQAAGIAVAPWVRFTAHEWATAPEEVLAS
LGSLGSPAFVKPARAGSSVGVSKVSTPDAFRAAIELALAEDSTVLVETGLVGREVECAVL
ESLPGETPRVSVAGEVVVTGRDFYDFEAKYLDAPGIELVCPADLRPEQLSEMQDLSRRAF
EALGCAGLARVDFFLTADGFVVNEVNTMPGFTPISMFPSCWLASGLSYPELITELIEVAR
ARS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgacgcacaagaccggagtggtggtgctctttggaggccgttcaagcgagcactcgatc
agctgcgcaacggcgggcggcgtcctcgccgcgattgaccgcgaacggtacgacgtctac
ccggtcgggatcgcccgcgacggctcgtacgtcctcgaggtcgacgacccgagccggtac
gcgctcgaccccgcgcacttgccggaggtcgacccctcgcggccggccatgcgctggcct
gagcgcgtcggcagccgtgagctgaccgtggtcggggaggacggcgtcccgttcaccctc
ggtcccatcgacatcgtcttcccgatcctccacggtcggttcggcgaggacggcaccgtg
cagggcatgctcgagctcgtcgacctcccgtacgtcggctccggcgtcctcgcgtcctcc
ctcggcatggacaagcacttcacgaagacggtgctccaggccgccgggatcgccgtcgcg
ccgtgggtgcggttcaccgcccacgagtgggccacggcacccgaggaggtgctcgcatcg
ctcggatcgctcgggtcaccggcgttcgtgaagccggcgcgagccgggtcgagcgtcggc
gtgtccaaggtgtcgacgccggacgcgttccgtgcagcgatcgaactggccctcgccgag
gactcgaccgtcctcgtcgagaccggtctggtgggccgagaggtcgagtgcgcggtcctc
gagtccctccccggcgagacacctcgggtctcggtggccggcgaggtcgtcgtgaccgga
cgcgacttctacgatttcgaggcgaaatacctcgacgcacccggtatcgagctcgtctgc
cccgccgaccttcgtcccgagcagttgtcggagatgcaggacctctcgcgtcgggcgttc
gaggcgttgggctgcgcggggctcgcccgggtcgacttcttcctgaccgcggacggcttc
gtcgtcaacgaggtcaacaccatgccggggttcaccccgatctcgatgttcccaagctgc
tggttggcctcgggactcagctaccccgagctcatcaccgagctgatcgaggtcgcgcgc
gcccgctcctga

DBGET integrated database retrieval system