KEGG   Plantibacter sp. PA-3-X8: EAO79_14770Help
Entry
EAO79_14770       CDS       T05731                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:plap00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    EAO79_14770
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:plap03400]
    EAO79_14770
Enzymes [BR:plap01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     EAO79_14770
DNA repair and recombination proteins [BR:plap03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     EAO79_14770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M LigD_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AZH84012
UniProt: A0A3G8VG04
LinkDB All DBs
Position
3126550..3128994
Genome map
AA seq 814 aa AA seqDB search
MARTSGGGGQTQWVDVDGRRIQLTHLDKVLYPETGTTKAEVLAYYAAVAEHLLPHLADRP
VTRKRWVHGVGTAASPESGFFQKDLGASAPDWVQRLPIEHSDHTNEYPIVDDLATLTWLA
QLGALELHVPQWRFDRSGERRPPDRLVLDLDPGEGVSLAECAGVAGLARAVLVDMGLDPV
PLTSGSKGIHLYAALDGRQSSAEVSLVAHELARALAADEPGLVVSEMSKQRRTGRVFVDW
SQNNGSKTTIAPFSLRGRSRPTVAAPRRWEELDDPGLAQLEFPAVLERLADGEDPLRVLG
DPRPSITIRPSEHEDRLVEYRRKRDAERTPEPVPEGPPAPPAAGTPPSFVIQRHEARKLH
HDFRLEHDGVLVSWALPKGVPTDPSSNHLAVRTEDHPIEYGSFEGTIPAGEYGAGEVTIW
DAGTYELEKWRDDEVIGTLHGRAGGALGGPMRFALIRTAGGTGREAPSWLIHRMRAPGDP
PAPPVARPRGIPTPMLASVAAPGELVDDGSWAFEMKWDGIRAIASVDGSTGRVRLSSRNG
KDLTTAYPEVVEELAASLAGRAVVLDGEIVASGPDGRPDFSLLQRRMQLTAERDVERERR
RTPVRLLLFDLLALDDTDRTELPYRERRELLERTIGSGTVVQVPPTIDGSLDDALEVSRG
LRLEGVMAKELDGRYRPGRRSSTWVKFKHERMEEVVVAGWRPGRGGRSGGIGSLLLGVPG
SDGLLHYAGRVGSGFSDRELAATALRFERLGRASTALVGVPPADAADANWVEPVLIGEVR
FSEWTPDGRFRHPVWRGWRPDRTVDDLEAPDRGR
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggacgagcggtggcggcgggcagacgcagtgggtcgacgtcgacggacgccgg
atccaactcacccatctcgacaaggtgctgtaccccgagaccggcacgacgaaggccgag
gtcctcgcctactacgccgcggtcgccgaacacctgctcccgcacctcgccgatcggccg
gtgactcggaaacgctgggtgcacggcgtcggcacggctgcgtcgccggagtcggggttc
ttccagaaggacctgggcgcctcggctcccgactgggtccaacggctccccatcgagcac
agcgatcacacgaacgagtacccgatcgtcgacgatctcgcgacactcacgtggctggcg
cagctgggtgcgctcgagctgcacgtgccgcagtggcggttcgaccgatccggcgagcgc
cgaccgcccgaccgtctcgtcctcgacctcgatccgggtgagggggtgtccctcgccgag
tgcgcgggggtcgcgggcctggcgcgggcggtgttggtggacatggggttggatccggtt
ccgctcacgagtgggagcaaggggatccacctgtacgcggcgttggacggtcggcagagt
tccgcggaggtgtcgctcgtggcgcatgagctcgcgcgggcgctggccgcggacgagccg
ggcctcgtggtgagcgagatgtcgaaacagcgacgcacggggagggtcttcgtcgactgg
agtcagaacaacgggtcgaagacgacgatcgcgccgttctcgttgcggggtcggtcacgg
ccgacggtggcggctccccgccggtgggaggagctcgacgatcctgggctggcgcagctg
gagttccctgcggtgctcgagcggctggcggacggtgaggacccgttgcgggtgctcggc
gacccgcgtccgtcgatcacgatccgcccgtcggaacacgaggaccggctcgtggagtac
cggcggaagcgggacgcggagcggacgcccgagcccgtcccggaaggaccgccggcgcct
cccgctgccgggacgccgccctcgttcgtgatccagcggcacgaggccaggaaactccac
catgacttccgactcgagcacgacggcgtgctggtgtcctgggccctgccgaagggggtg
ccgacggatccgagcagcaaccatctggcggtgcgcacggaggaccaccccatcgagtac
ggcagtttcgagggcacgatccctgctggtgagtacggggccggtgaggtgaccatctgg
gacgcgggcacctacgagctggagaagtggcgcgacgacgaggtcatcgggaccctgcac
ggccgggcgggaggtgcgctcggcgggccgatgcggttcgcgctcatccggaccgcgggc
gggacgggacgggaggcgccgtcgtggctcatccaccggatgcgcgccccgggcgacccg
ccggctcccccggtcgcacggcctcgggggatccccacccccatgctcgcgagtgtcgcg
gcacccggcgagctggtcgacgacggatcctgggcgttcgagatgaagtgggacggcatc
cgtgcgatcgcgagcgtcgacggctcgacggggcgggtgcggttgtcgagccggaacggc
aaggacctcacgacggcgtacccggaggtggtcgaggaactcgcggcgtcgctcgccggc
cgtgcggtcgtcctcgacggcgagatcgtggcgtcgggtcctgacggccgtcccgacttc
tcgctgctgcagcgtcggatgcagctcaccgcggagcgggacgtcgaacgggagcgccgt
cggacgccggtccggctgctgctgttcgacctgctcgcgctggatgacacggatcggacg
gagctgccctaccgggagcgtcgcgaactgctcgagcggacgatcggatccgggaccgtc
gtccaggtgccaccgacgatcgacggctcgctcgacgatgcgctcgaggtgagtcggggg
ttgcggttggagggggtgatggcgaaggagctcgacggacgctaccgcccgggtcggcgc
agcagcacctgggtcaagttcaagcacgaacgcatggaggaggtcgtcgtggccggctgg
cgtcccggtcggggcgggcgctcgggtgggatcgggtcgctcctgctcggggtgccgggc
tcggacgggttgctgcactacgcgggacgggtcggaagcggcttcagcgatcgggagttg
gcggcgaccgcgctccgcttcgaacggctgggccgggcatcgacggccctcgtgggtgtc
ccgccggccgatgcggccgacgccaactgggtggaacccgtcctcatcggggaggtccgc
ttcagcgagtggacaccggacggacggttcaggcatccggtctggcgtgggtggcgcccc
gatcggacggtggacgacctcgaagcgccggaccgcggacgctga

DBGET integrated database retrieval system