KEGG   Plantibacter sp. PA-3-X8: EAO79_17135Help
Entry
EAO79_17135       CDS       T05731                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00020  Citrate cycle (TCA cycle)
plap00190  Oxidative phosphorylation
plap00650  Butanoate metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01130  Biosynthesis of antibiotics
plap01200  Carbon metabolism
Module
plap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
plap_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAO79_17135
   00650 Butanoate metabolism
    EAO79_17135
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EAO79_17135
Enzymes [BR:plap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EAO79_17135
    1.3.5.4  fumarate reductase (quinol)
     EAO79_17135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO HI0933_like
Motif
Other DBs
NCBI-ProteinID: AZH84424
UniProt: A0A3G8VF70
LinkDB All DBs
Position
3655909..3657711
Genome map
AA seq 600 aa AA seqDB search
MTTETTESTVIDGIHYHQFDIVIVGAGGAGMRAAIEAGPGAKTAVISKLYPTRSHTGAAQ
GGMAAALANVEEDSWEWHTFDTIKGGDYLVDQDAAEILAKEAIDAVIDLENMGLPFNRTP
EGKIDQRRFGGHTRDHGKAPVRRACYAADRTGHMILQTLFQNCVRLGINFFNEYYALDLI
MTNVDGVDKPSGVVAYELSTGEIHVFQAKAVIFATGGFGKIYKTTSNAHTLTGDGVGIIW
RKGLPLEDMEFFQFHPTGLAGLGILLTEGARGEGAILRNASGERFMERYAPTIKDLAPRD
IVARCMVQEVAEGRGAGPNKDYVYLDCTHLGAEVLETKLPDITEFARTYLGVDPVTEPVP
VMPTAHYAMGGIPTNVKAEVLSDNNTVVPGLYAAGECACVSVHGSNRLGTNSLLDINVFG
KRAGNNAVEYVQGVDFTPLPENPAGFVSGLIEQMRNSNGTERISTIRKELQEEMDRNAQV
FRTDESLAGVTATIHNLRERYQNIAVQDKGKRFNTDLLEAIELGFLLDLAEVVVYSARNR
QESRGGHMRDDYPKRDDENYMKHTMAYLSGDPHSSDAADHIRLDWKPVVITRYQPMERKY
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
gtgactacagaaaccaccgagtccaccgtcatcgacggcatccactaccaccagttcgac
atcgtgatcgtcggtgccggcggtgccggcatgcgcgccgcgatcgaggccggccccgga
gcgaagacggccgtcatctccaagctctacccgacgcggtcccacacgggagcggcgcag
ggcggtatggccgctgcgctcgcgaacgtcgaggaggacagctgggaatggcacaccttc
gacaccatcaagggcggcgactacctcgtcgaccaggatgcggcggagatcctcgcgaag
gaggccatcgacgcggtcatcgacctcgagaacatgggtctgccgttcaaccgcaccccc
gagggcaagatcgaccagcgtcgcttcggcggccacacccgcgaccacggtaaggcgccg
gtccgccgtgcctgctacgcggccgaccgcacgggccacatgatcctgcagacgctgttc
cagaactgcgtccgcctcggcatcaacttcttcaacgagtactacgcgctcgacctgatc
atgacgaacgtcgacggtgtcgacaagccgtccggtgtggtcgcgtacgagctctccacc
ggcgagatccacgtcttccaggcgaaggcggtcatcttcgccaccggtggcttcggcaag
atctacaagacgacctcgaacgcccacaccctcacgggcgacggcgtcgggatcatctgg
cgcaagggtctcccgctcgaggacatggagttcttccagttccaccccaccggcctcgcc
ggtctcggcatcctcctcaccgagggagcgcgaggtgagggtgcgatcctccggaacgcg
agcggtgaacgcttcatggagcggtacgccccgaccatcaaggacctcgccccgcgagac
atcgtcgcgcgctgcatggtccaggaggtcgcggaaggccgcggtgccgggccgaacaag
gactacgtctacctcgactgcacccacctcggtgccgaggtcctcgagaccaagctgccc
gacatcaccgagttcgcgcgcacctacctcggtgtcgacccggtgacggagcccgtccct
gtcatgccgaccgcgcactacgccatgggcggcatcccgacgaacgtcaaggccgaggtc
ctgagcgacaacaacaccgtcgtccccggcctgtacgcggccggcgaatgcgcgtgcgtg
tccgtccacggctcgaaccggctcggcacgaactcgctcctcgacatcaacgtgttcggc
aagcgcgccggcaacaacgccgtcgagtacgtccagggcgtcgacttcacgccactgccc
gagaaccccgccggcttcgtctccggcctcatcgagcagatgcggaactccaacggcacc
gagcggatctccacgatccgcaaggagctgcaggaggagatggaccgtaacgcccaggtg
ttccggaccgacgagtccctcgccggcgtcaccgccaccatccacaacctgcgcgagcgg
taccagaacatcgccgtccaggacaagggcaagcgcttcaacacggacctcctcgaggcg
atcgagctgggcttcctgctcgacctcgccgaggtcgtcgtctactccgctcgcaaccgt
caggagagccgtggcggtcacatgcgcgacgactacccgaagcgcgacgacgagaactac
atgaagcacacgatggcgtacctgtccggcgacccgcactcgtccgacgcggccgaccac
atccggctcgactggaagcccgtggtcatcacgcggtaccagccgatggagaggaagtac
tag

DBGET integrated database retrieval system