KEGG   Plantibacter sp. PA-3-X8: EAO79_17140Help
Entry
EAO79_17140       CDS       T05731                                 

Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00020  Citrate cycle (TCA cycle)
plap00190  Oxidative phosphorylation
plap00650  Butanoate metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01130  Biosynthesis of antibiotics
plap01200  Carbon metabolism
Module
plap_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plap_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
plap_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAO79_17140
   00650 Butanoate metabolism
    EAO79_17140
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EAO79_17140
Enzymes [BR:plap01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EAO79_17140
    1.3.5.4  fumarate reductase (quinol)
     EAO79_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_7 Fer4_9 Fer4 Fer4_6 Fer4_4 Fer4_18 Fer4_20 Fer4_2 Fer4_15 Fer4_16 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AZH84425
UniProt: A0A3G8VVF1
LinkDB All DBs
Position
3657714..3658481
Genome map
AA seq 255 aa AA seqDB search
MSTATLENPPAAAPEEIQSFTVTLIIRRFDPDVDAEPRWEDFDVEMFPTDRILDALHKIK
WEQDGTLTFRRSCAHGICGSDAMRINGRNRLACKTLIKDLDISKPIYVEAIKGLPLEKDL
VVDMDPFFASFREVQPFLMPGKPAEKNKERVQSVAERARFDDTTKCILCAACTSSCPVFW
TDGQYFGPAAIVNAHRFIFDSRDDASQVRLDILNDQEGVWRCRTTFNCTEACPRGIQVTQ
AIAEVKQAMISGKVS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcaacgctcgagaacccgccggcagcagcaccggaggagatccagtccttc
acggtcaccctgatcatccgtcgattcgacccggacgtggacgccgagccgcgctgggag
gacttcgacgtcgagatgttcccgacggaccgcatcctggacgcgctccacaagatcaag
tgggagcaggacgggaccctcacgttccgtcgctcctgcgcgcacggcatctgcggctcc
gacgccatgcggatcaacggacggaaccgcctcgcctgcaagacgctgatcaaggacctc
gacatctcgaagccaatctacgtcgaggcgatcaagggcctgccgctcgagaaggacctc
gtcgtcgacatggaccccttcttcgcgtcgttccgcgaggtgcagccgttcctcatgccc
ggcaagcctgcggagaagaacaaggagcgcgtgcagtcggtcgccgagcgcgcccgcttc
gacgacaccacgaagtgcatcctgtgcgccgcgtgcacctcgtcgtgccccgtgttctgg
accgacggccagtacttcggcccggcggcgatcgtgaacgcgcaccgcttcatcttcgac
tcccgcgacgacgcctcgcaggtccgcctggacatcctcaacgaccaggagggcgtgtgg
cgctgccgcaccaccttcaactgcaccgaggcgtgcccccgcggcatccaggtcacgcag
gcgatcgccgaagtcaagcaggccatgatctccggcaaggtctcctag

DBGET integrated database retrieval system