KEGG   Plantactinospora sp. BB1: C6W10_08180Help
Entry
C6W10_08180       CDS       T05391                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00564  Glycerophospholipid metabolism
plat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C6W10_08180
Enzymes [BR:plat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     C6W10_08180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 GIDA NAD_binding_8 Pyr_redox HI0933_like 3HCDH_N AlaDh_PNT_C Thi4 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AVT36457
UniProt: A0A2R4FG14
LinkDB All DBs
Position
1929782..1931605
Genome map
AA seq 607 aa AA seqDB search
MRDPSLSRNEASRLSPSRRAADLRRLRSERFDVLVIGGGVTGAGAALDAASRGLKVALVE
ARDFASGTSSRSSKLIHGGLRYLEQLEFHLVHEALTERGLLATRLAPHLVRPVPILVPLP
PGSGPAGLAGRAWRRSYYGTGVAAYDAFAGIFGGGRGMPLHRHLTREGARRTFPSLRADA
ISGAIRYYDGQVDDARLVVTLARTAASLGAATVNSARVVGLLRQAREVTGVRVRDMEAPP
GSPDAEFEVRARTVIAATGVWSDDMSELLGDVGVRRGLRVRASKGVHLVVPRSAITGEAG
LILRTPTSVLFVIPWGGHWIIGTTDTDWRLDRAHPAASARDIDYLLDQVNTVLDRPLTTA
DIEGVYAGLRPLLSGEADSTSKLSREHAVYEPMLGLLLVAGGKYTTYRVMAADVVDRAAR
RLGGVRASRTADLPLVGADGYAALWRDRADLARRHGVQAGVVEHLLERYGNLTTHLLEMV
DAEPLLGSPLAGAPEYLAAEVAYAARAEGALHLDDVLTRRTRISFETVHRGVESAEQAAE
IMGRVLGWDARVRAREVEHYLARVQAERQSQRMPDDATADAARVGAPDVRGFAADRGAGR
DGAELAG
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgaccccagcctttcccggaacgaggccagccggctctccccgtcccgccgcgcc
gccgacctacgacggctgcggagcgagcgcttcgacgtactcgtcatcggtggtggggtg
accggcgcgggggcggcactcgacgccgcctcccgagggctcaaggtggccctggtcgag
gcccgcgacttcgcctccggcacctccagccggtccagcaagctgatccacggcgggctg
cgctacctggagcaactggagttccacctggtccacgaggcgctgaccgagcggggcctg
ctcgccacccggctcgcaccgcacctggtgcgcccggtgccgatcctggtgccgctgccg
cccggcagcggtccggccggactcgccggccgggcctggcgacgctcctactacggcacc
ggggtcgcggcctacgacgccttcgccgggatcttcggcggcgggcggggcatgccgctg
caccggcacctcacccgggagggagcccggcgcaccttcccgagcctccgcgccgacgcg
atctccggggcgatccgctactacgacgggcaggtcgacgacgcccgcctggtggtcacc
ctggcccgcaccgcggccagcctgggcgcggcgaccgtgaacagcgcccgcgtcgtcggc
ctgctccggcaggcccgcgaggtgacgggggtacgggtccgggacatggaggcgccgccc
ggctccccggacgccgagttcgaggtacgcgcccgcaccgtcatcgccgccaccggagtg
tggagcgacgacatgtccgaactcctcggcgacgtcggcgtgcggcgcggcctgcgggta
cgggcctccaagggggtacacctggtggtgccccgctcggcgatcaccggcgaggccgga
ctgatcctgcgtaccccgacctcggtgctcttcgtgatcccgtggggcgggcactggatc
atcggtaccaccgacaccgactggcggctcgaccgggcccacccggcggcctcggcccgg
gacatcgactacctgctcgaccaggtcaacaccgtgctggaccggccgctgaccaccgcc
gacatcgagggcgtctacgccgggctgcgcccgctgctgagcggcgaggcggactcgacc
tcgaagctctcccgggaacacgccgtctacgagccgatgctcgggctgctgctggtggcc
ggcgggaaatacacgacgtaccgggtgatggccgccgacgtggtcgaccgggccgcccgc
cggctcggcggggtacgcgcctcacgcaccgccgacctgccgctggtcggcgccgacggc
tacgccgcgctgtggcgggaccgggccgacctggcccgccggcacggcgtacaggccggg
gtggtcgaacacctgctggagcggtacggcaacctcaccacccacctgctggagatggtc
gacgccgagccgctgctcggctccccgctggccggggcgccggagtacctcgccgccgag
gtggcgtacgcggcccgggccgagggggcgctgcacctcgacgacgtgctgacccggcgt
acccggatctcgttcgagacggtgcaccggggcgtcgagtcggccgagcaggccgccgag
atcatggggcgggtgctcggctgggacgcccgggtccgggcccgcgaggtcgagcactac
ctggcccgggtgcaggcggaacggcagtcgcagcggatgccggacgacgccaccgccgac
gcggcccgggtcggggcgccggacgtgcgcggtttcgccgccgaccggggcgccggccgg
gacggggcggaactggccggctga

DBGET integrated database retrieval system