KEGG   Plantactinospora sp. BB1: C6W10_10765Help
Entry
C6W10_10765       CDS       T05391                                 

Gene name
sodN
Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
plat  Plantactinospora sp. BB1
Brite
KEGG Orthology (KO) [BR:plat00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C6W10_10765 (sodN)
Enzymes [BR:plat01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C6W10_10765 (sodN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: AVT36873
UniProt: A0A2R4FH67
LinkDB All DBs
Position
complement(2499593..2500000)
Genome map
AA seq 135 aa AA seqDB search
MRLPRILTPRTVAYAHCDLPCGVYDPAQARIEAESIKAIDEKYAANTDPEFRTRALIIKE
QRSELVKHHLWVLWTDYFKPPHFEKYPQLHQLFNEATKLAGGGGGTKATTDASKADELLQ
KIDEIAKIFWETKQA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccacgcatccttacaccacgaactgtcgcgtacgcccactgcgacctgccc
tgcggcgtatacgacccggcgcaggcccggatcgaggccgagtcgatcaaggcgatcgac
gagaagtacgcggcgaacaccgaccccgagttccgcacccgggcgctgatcatcaaggag
cagcgctccgagctggtcaagcaccacctctgggtgctctggaccgactacttcaagccc
ccgcacttcgagaagtacccgcagctgcaccagctgttcaacgaggccaccaagctcgcc
ggtggcggcgggggcaccaaggccacgaccgacgcgtcaaaggccgacgagctgctccag
aagatcgacgagatcgcgaagatcttctgggagaccaagcaggcgtaa

DBGET integrated database retrieval system