KEGG   Plantactinospora sp. BB1: C6W10_14245Help
Entry
C6W10_14245       CDS       T05391                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C6W10_14245
Enzymes [BR:plat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     C6W10_14245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4159 DUF4350 YacG
Motif
Other DBs
NCBI-ProteinID: AVT37440
UniProt: A0A2R4FIU3
LinkDB All DBs
Position
complement(3263040..3265115)
Genome map
AA seq 691 aa AA seqDB search
MSQTPHLVVTATDAPGQAGPLPRLDRLAYGGDYNPEQWPEHVWAEDVELMRTAGVNLVSV
GIFSWALLEPAEGSFDFGWLDRLLDRLHDGGISVDLATPTAVPPAWFRRRHPEARLVDRH
GVALGGGARQSFCPSSPAYAEASARITEALARRYAEHPALVLWHSHNEYGGVNALCYCAT
SAAAFRDWLRDRYGDLPRLNDAWGTTFWGQRYGDWAEIEPPLAAPTAVNPAQQLDFLRFS
SDAHLGNFRRERDILHRLCPGVPVTTNFMLANCKTIDYWRWADEVDVVSNDHYLRAEEPD
NHIELAMCADLTRAVAGGRPWLLMEHSTSAVNWQPRNIAKRPGELRRNSLTHLARGAESV
LFFQWRAARFGAEKFHSAMLPHGGTETRIWREVVALGAELPALEPLRGTRVVADVAVLWD
WESWWAVELDWRPSVDLDYRERMAAYYERLWRDRLTVDFAHPERPLDDYRLVVVPSLYLT
TPAAAENLRRYVAGGGTLLVSYFSGIADADDAVHPGGYPGALRDLLGLTVEEFLPLRSGE
TLRLGPATGDTSETGAAPLTGDVWAEAVLPHGAEPVLRYLDGPAAGGPAVTRHSLGAGHA
WYVSTRLDAAGLAPVLRAAYRDAGLVSPDGVPDGVELVRRAGADGSRFLIAINHADRDAE
LPATGTDLVDGSVHDGVLRVPAGGVRVLRTG
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagaccccgcatctggtggtaaccgcgacggacgcaccggggcaggccgggccg
ttgccccggctcgaccggctggcgtacggcggggactacaaccccgagcagtggccggag
cacgtctgggccgaggacgtcgagttgatgcgtaccgccggggtgaacctggtcagcgtc
gggatcttctcctgggccctgctggagcccgccgaggggagcttcgacttcggctggctc
gaccggctcctcgaccggctgcacgacggcgggatatccgtcgacctggccaccccgacc
gccgtacccccggcctggttccgccggcgccacccggaggcccggttggtcgaccggcac
ggcgtggcgctgggcggcggagcacggcagtccttctgccccagctcacccgcgtacgcc
gaggccagcgcccggatcaccgaggcgctggcccggcgctacgccgaacacccggcgctg
gtgctgtggcactcgcacaacgagtacggcggggtcaacgcgctctgctactgcgccacc
tcggcggccgcgttccgggactggctgcgcgaccggtacggcgacctgccccgcctcaac
gacgcctggggcaccaccttctggggccagcggtacggcgactgggccgagatcgagccg
ccgctcgccgcgccgaccgcggtcaacccggcccagcagctcgacttcctgcgcttctcc
tccgacgcgcacctgggcaacttccgccgggagcgggacatcctgcaccgcctctgcccc
ggcgtaccggtgaccaccaacttcatgctggccaactgcaagaccatcgactactggcgc
tgggccgacgaggtggacgtggtctccaacgaccactacctgcgggccgaggagccggac
aaccacatcgagctggcgatgtgcgccgacctgacccgggcggtcgccgggggccggccc
tggctgctgatggaacactccacttcggcggtgaactggcagccgcgcaacatcgccaag
cgccccggcgaactgcgccgcaacagcctgacccacctggcccggggcgccgagtcggtg
ctcttcttccagtggcgggccgcccggttcggcgcggagaagttccacagcgcgatgctg
ccgcacggcggcaccgagacccggatctggcgcgaggtggtggcgctcggcgccgagctg
cccgccctggaaccgctgcgcgggacccgggtggtcgccgacgtcgcggtgctctgggac
tgggagtcctggtgggccgtcgagctggactggcgcccctcggtcgacctggactaccgg
gagcggatggcggcgtactacgaacgactctggcgggaccggctcaccgtcgacttcgcc
cacccggaacggccgctggacgactaccggctggtcgtggtgccgagcctgtacctgacc
accccggccgccgccgagaacctccgccggtacgtcgccggaggcggcacgctgctggtc
tcgtacttctccgggatcgcggacgccgacgacgccgtacatccggggggttatccgggg
gcgctgcgggacctgctcggcctgaccgtcgaggagttcctgccgctgcgctccggcgag
acgctacgcctcggtccggccaccggggacacctcggagaccggggccgccccgctgacc
ggggacgtctgggccgaggcggtgctgccgcacggggcggagccggtgctgcgctatctg
gacggtccggccgccggtggccccgccgtcacccgacactccctcggcgccggccacgcc
tggtacgtctccacccggctggacgcggccgggctggccccggtgctccgggcggcgtac
cgggacgccggcctggtctcgccggacggggtgccggacggggtcgaactggtccggcgg
gcgggtgcggacgggagccggttcctgatcgctatcaaccacgccgaccgggacgcggag
ctgccggccaccggcaccgatctggtcgacggcagcgtccacgatggagtcctccgggtg
ccggccggcggcgtacgggtgctgcgcaccggctga

DBGET integrated database retrieval system