KEGG   Plantactinospora sp. BB1: C6W10_14820Help
Entry
C6W10_14820       CDS       T05391                                 

Definition
(GenBank) uracil-DNA glycosylase
  KO
K21929  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:plat00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    C6W10_14820
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:plat03400]
    C6W10_14820
Enzymes [BR:plat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     C6W10_14820
DNA repair and recombination proteins [BR:plat03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     C6W10_14820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG TFIIA_gamma_C
Motif
Other DBs
NCBI-ProteinID: AVT37533
UniProt: A0A2R4FJ18
LinkDB All DBs
Position
3395368..3396066
Genome map
AA seq 232 aa AA seqDB search
MPETETAPGAQEFIPPDAGSLAELRDAAGGCRGCELYRDATQTVFGRGDEHARVVFVGEQ
PGDMEDQKGLPFVGPAGHLLRRAVDEAGIDPAQLYITNAVKHFRFEMRGKRRLHKTPDRV
HIVACRPWLVAEFARLHPEVVVVLGATAAKALLGPSFRVTQSRGVLLPWPESAQRPQDFA
KVPVGPTGERETVAPTRLVATIHPSAVLRADDRDAAYAGLVDDLKVVAGALG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagacggagaccgcgcccggagcgcaggagttcatcccgcccgacgccggcagc
ctggccgagctgcgcgacgcggccggcggctgccggggctgcgagctgtaccgggacgcc
acccagacggtcttcggccggggtgacgagcacgcccgggtggtcttcgtcggcgagcag
cccggcgacatggaggaccagaagggactgccgttcgtcgggccggccgggcacctgctg
cggcgggcggtggacgaggccggcatcgacccggcgcagctctacatcaccaacgcggtc
aagcactttcgcttcgagatgcgcggcaagcgccggctgcacaagacgccggaccgggtg
cacatcgtcgcctgccggccctggctggtcgccgagttcgcccggctgcaccccgaggtg
gtggtcgtgctcggcgcgacggcggccaaggcgctgctcggcccctcgttccgggtcacc
cagtcccggggcgtactcctgccctggccggagtcggcgcagcggccgcaggacttcgcc
aaggtaccggtcgggccgaccggcgagcgggagacggtcgcgccgacccggctggtcgcc
accatccacccctcggcggtgctccgcgccgacgaccgggacgccgcctacgccggcctg
gtcgacgacctgaaggtggtggccggggcgctgggttga

DBGET integrated database retrieval system