KEGG   Plantactinospora sp. BB1: C6W10_15365Help
Entry
C6W10_15365       CDS       T05391                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
plat  Plantactinospora sp. BB1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AVT37619
UniProt: A0A2R4FJJ0
LinkDB All DBs
Position
complement(3512677..3513771)
Genome map
AA seq 364 aa AA seqDB search
MELPINPPVEPMLAKSVPKIPTGPGMSYEPKWDGFRCIVFRDGDEVELASRGGKTMTRYF
PEVVAQARAQLPTRCAVDGELIVIRRDGPDGGPRLDFDLLSQRIHPAASRVNMLAETTPA
DLVAFDLLAIGDELLIDQPYERRRTRLVEALRGVVPPVHVTQTTTDPETAARWFEIFEGA
GLDGLVAKPADIPYEPGKRLMFKVKHTRTADVVVAGFRWHKSGPVVGSLLLGLHDEAGTL
HHVGVSASFSAARRAELLDELAPYREGVKEHPWVHGDHTSGQRIPGGPSRWSGTKSLEWE
PLRPELVAEVGYDAMEGDRFRHTAQFVRWRPDREPASCGYDQLDRPIRFDVDQVLRGDPL
APGA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtggagctgccgatcaacccgccggtcgagccgatgctggccaagagcgttccgaagatc
cccaccggtccggggatgagctacgagccgaagtgggacggtttccggtgcatcgtcttc
cgggacggcgacgaggtcgagctggccagccggggcggcaagacgatgacccgctacttc
ccggaggtcgtcgcgcaggcccgggcgcagctgccgacccgctgcgcggtcgacggcgag
ctgatcgtgatccgccgggacggcccggacggcgggccccggctcgacttcgacctgctc
agccagcgcatccacccggccgcgtcccgggtcaacatgctggccgagaccaccccggcc
gacctggtcgccttcgacctgctcgccatcggcgacgagttgctgatcgaccagccctac
gagcggcgccggacccgcctcgtcgaggcactgcgcggggtcgtacccccggtgcacgtc
acccagaccaccaccgacccggagacggcggcccggtggttcgagatcttcgagggcgcc
gggctggacgggctggtcgccaagcccgccgacatcccctacgagcccggcaagcggctg
atgttcaaggtcaagcacacccggaccgccgacgtggtggtcgccgggttccgctggcac
aagtccggcccggtggtcggttcgctgctgctcggcctgcacgacgaggcgggcacgctg
caccacgtcggcgtctcggcgtcgttcagcgccgcccgccgggccgagctgctcgacgag
ctggccccctaccgcgagggcgtcaaggagcacccgtgggtgcacggcgaccacaccagc
gggcagcgcatcccgggcgggccgagccggtggtccggcaccaagagcctggagtgggag
ccgctccgcccggagctggtggccgaggtcggctacgacgcgatggagggcgacaggttc
cggcacaccgcccagttcgtccgctggcggcccgaccgggagccggcctcctgcgggtac
gaccaactcgaccgcccgatccggttcgacgtcgaccaggtgctccgcggcgacccgctc
gcccccggcgcgtag

DBGET integrated database retrieval system