KEGG   Plantactinospora sp. BB1: C6W10_29055Help
Entry
C6W10_29055       CDS       T05391                                 

Definition
(GenBank) DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:plat00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    C6W10_29055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:plat03400]
    C6W10_29055
Enzymes [BR:plat01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     C6W10_29055
DNA repair and recombination proteins [BR:plat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     C6W10_29055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_ligase_OB_2 DUF5415
Motif
Other DBs
NCBI-ProteinID: AVT41897
UniProt: A0A2R4FWK8
LinkDB All DBs
Position
6669398..6670351
Genome map
AA seq 317 aa AA seqDB search
MPGTPVKPMLAVTGELPAGPGWVHEFKWDGVRAVSDFAGDELRLYARSGVQITAAYPELA
PLGAQLAQRGLADAVLDGEVVVLTEQGQPSFTALAERMHVREPARAARLAVSLPVTYMIF
DLLRRDGTDLTGWPYQRRREALESLGLAGPRWAVPPVFPDGRATYQAAGEHGLEGVVSKR
VDAVYRAGVRSPDWVKVKLEVTDDFVVGGWRPGVRRIGGLLVGVPAPDGGLVYRGRVGGG
IGAAIERELLAVLEPLRNGTSPFVTPVPREDARGAIWVTPQIVVEVKYGQRTPDGRLRFP
RIRRLRTDKTVADVDGA
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcccggcaccccggtcaagccgatgctcgcggtcaccggggagctgcccgcaggcccc
ggctgggtgcatgagttcaagtgggacggggtgcgggcggtctccgacttcgccggtgac
gagctgcggctctacgcgcgctccggggtgcagatcaccgccgcctatccggaactcgcc
ccgctgggcgcccagctcgcgcagcgcgggctggccgacgcggtgctggacggcgaggtg
gtggtgctgaccgagcaggggcagccgtcgttcaccgcgctcgccgagcggatgcacgtg
cgggagccggcccgggccgcccggctggcggtgagcctcccggtgacgtacatgatcttc
gacctgctgcggcgggacgggacggacctgaccgggtggccgtaccagcgccgccgggag
gcgctggagtcgctcggcctggccgggccgcgctgggcggtaccgccggtcttcccggac
ggccgggccacctaccaggcggccggcgagcacgggctggagggcgtggtgtcgaaacgg
gtcgacgccgtctaccgggccggggtccggtcgccggactgggtgaaggtgaaactggag
gtcaccgacgacttcgtggtcggaggctggcggcccggcgtacgccggatcggtgggctg
ctggtcggagtgccggcgccggacggcggcctggtctaccggggtcgggtcggcggcggc
atcggcgcggcgatcgagcgggaactgctggccgtactggagccgctgcgcaacggaacc
tcgcccttcgtgaccccggtgccccgggaggatgcccggggcgcgatctgggtaactccc
cagatcgtggtggaggtgaagtacggccagcgcacgccggacggtcggctgcggttcccg
cggatccgccggctgcgcaccgacaagacggtggcggacgtcgatggcgcgtga

DBGET integrated database retrieval system