KEGG   Plantactinospora sp. BB1: C6W10_30075Help
Entry
C6W10_30075       CDS       T05391                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00473  D-Alanine metabolism
plat00550  Peptidoglycan biosynthesis
plat01100  Metabolic pathways
plat01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    C6W10_30075
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C6W10_30075
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C6W10_30075
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:plat01011]
    C6W10_30075
Enzymes [BR:plat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     C6W10_30075
Peptidoglycan biosynthesis and degradation proteins [BR:plat01011]
 Precursor biosynthesis
  Amino acid ligase
   C6W10_30075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_3 CPSase_L_D2 ATPgrasp_ST RimK TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AVT41929
UniProt: A0A2R4FWM0
LinkDB All DBs
Position
complement(6885171..6886202)
Genome map
AA seq 343 aa AA seqDB search
MGTHSADDPLLAAEWPDLVPQEATAELRVLVLAGGLSYERDVSLKSGRRVLDALRSVGVE
AELRDADVSLLPLLRDDPPDAVVIALHGSTGEDGSLRGVLDICDVPYVGCDARSSRLAWD
KPSAKAVLREDGIPTPDWVALPHDRFSELGAVAVLDRIVDRLGLPLMIKPAQGGSGLGAA
VVRDPAALPAAMVGCFAYDSTALVERFVPGMDVAVSVVDLGDGPRALPAVEIVPRNGVYD
YAARYTAGLTTWHAPARLSASAAARVAETALAAHAALGLRDLSRVDLIVDEDDRPHVLEV
NVSPGMTETSLLPLAVGAAGLDFGELLRTLVARAAQRRTPGRP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtacccactccgccgacgatccgctactcgccgccgaatggccggacctcgtacca
caggaggccacggcggagctgcgggtactcgtactcgccggtggactctcctacgagcgg
gacgtgtcgctgaagtccggtcgacgggtactcgacgcgctccgctcggtgggagtggag
gcggaactgcgggacgccgacgtctcgctgctgccgctgctccgcgacgatcccccggac
gcggtggtgatcgccctgcacgggtcgaccggcgaggacggctcgctgcgcggcgtactc
gacatctgcgacgtgccgtacgtcggctgtgacgcccggtcgtcccgactggcctgggac
aagccgtcggcgaaggcggtactccgcgaggacggcatccccaccccggactgggtggcg
ctgccgcacgaccggttctccgaactcggggcggtggcggtgctggaccggatcgtcgac
cggctcggactgccactcatgatcaagccggcccagggcggctcgggtctcggcgccgcc
gtggtccgggaccccgccgcactcccggcggcgatggtcggctgcttcgcgtacgactcg
acggcgctcgtggagcgcttcgtacccggaatggacgtggcggtctcggtggtcgacctg
ggcgacggcccgcgcgcgctgcccgccgtcgagatcgtcccgcgcaacggcgtatacgac
tacgccgcccggtacaccgccgggctcaccacctggcacgccccggcccggttgtcggcc
agcgcggcggcccgggtcgcggagaccgccctcgcggcccacgccgcgctcgggctccgc
gacctgtcccgggtggacctgatcgtcgacgaggacgaccggccgcacgtgctggaggtc
aacgtctcgcccgggatgaccgagacctcgctgctcccgctcgccgtgggcgccgccggg
ctcgatttcggcgagctgctgcgcacgctggtcgcccgcgccgcccagcgccgcaccccc
ggccgcccctga

DBGET integrated database retrieval system