KEGG   Plantactinospora sp. BB1: C6W10_33115Help
Entry
C6W10_33115       CDS       T05391                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00250  Alanine, aspartate and glutamate metabolism
plat00410  beta-Alanine metabolism
plat00640  Propanoate metabolism
plat00650  Butanoate metabolism
plat01100  Metabolic pathways
plat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    C6W10_33115
   00650 Butanoate metabolism
    C6W10_33115
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    C6W10_33115
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    C6W10_33115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plat01007]
    C6W10_33115
Enzymes [BR:plat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     C6W10_33115
Amino acid related enzymes [BR:plat01007]
 Aminotransferase (transaminase)
  Class III
   C6W10_33115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AVT40496
UniProt: A0A2R4FSN6
LinkDB All DBs
Position
complement(7559740..7561062)
Genome map
AA seq 440 aa AA seqDB search
MTTDDLLARHRAVMPSWMPLYYAEPIEIVAGSGRRVTDAQGRGYLDFFGGVLTNMLGYDV
AEVNEAVRRQLDTGVVHTSTLYLIRQQVELAEKIAALSGIPDARVFFTNSGTEANEAALL
VATNHRRSNQILAVRNSYHGRSYAAMGITGHRSWSASSLNPLQVSWLHSGDRLRGLLARL
GPDEYVEAAVDDLREVLATQTSGDVACLIAEPIQGVGGFVAPPDGLLGAYKKVLDESGIL
LISDEVQTGWGRTGEHFWGYQAHGVTPDLLTFAKGIGNGFALAGVVGRAEVLDEVHAVSF
STFGGNPVSTAAGNAVLDYLLAHDLQANAARVGAVLLAGLRELADRHAVVAEVRGKGLML
GVEFVRPGSTEPDPAATNRVFEECRRGGLLVGKGGLHGNVLRMGPPLTLTEEEAREALGI
LAGAVALVDAEAVAVADRAG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgacgatctgctggcgcggcaccgggccgtgatgccgtcctggatgccgctg
tactacgccgagccgatcgagatcgtcgccggttccggtcgccgggtcaccgacgcgcag
gggcgcggttacctggacttcttcggcggtgtgctgacgaacatgctcggttacgacgtc
gccgaggtgaacgaggcggtgcgccgccagctcgacaccggggtggtgcacacctcgacc
ctctatctgatccggcagcaggtggagctggccgagaagatcgccgcgctctccggcatc
ccggacgcccgggtcttcttcaccaactccggcaccgaggcgaacgaggcggcgctgctg
gtcgccacgaaccaccggcggtcgaaccagatcctggcggtgcggaacagctaccacggc
cggtcgtacgcggcgatggggatcaccgggcaccggagctggtcggcgagcagcctcaac
ccgctccaggtgagctggctgcactccggtgaccggctgcgcggcctgctggcccggctc
ggcccggacgagtacgtggaggcagccgtcgacgacctgcgcgaggtgctggccacccag
accagcggggacgtggcctgcctgatcgccgagccgatccagggggtgggcgggttcgtg
gccccgccggacgggctcctcggcgcgtacaagaaggtgttggacgagtccggcatcctg
ctcatctccgacgaggtgcagaccggctggggacggaccggggagcacttctggggctac
caggcgcacggcgtcacgccggacctgctcaccttcgccaagggcatcggcaacggcttc
gccctggccggggtggtcggccgggccgaggtgctcgacgaggtgcacgcggtctccttc
tccaccttcggcggcaaccccgtctcgacggcggccggcaacgccgtcctggactacctg
ctcgcgcacgacctccaggccaacgccgcccgggtcggcgcggtgctcctcgccgggctg
cgcgagctggccgaccggcacgccgtggtcgccgaggtgcgcggcaaggggctgatgctc
ggcgtcgagttcgtccggcccggcagcaccgagcccgatccggcggccaccaaccgggtc
ttcgaggagtgccggcggggcggcctgctggtcggcaagggcggcctccacggcaacgtg
ctgcggatgggtccgccgctgacgctgaccgaggaggaggcccgggaggcgctggggatc
ctcgccggggccgtcgcgctggtcgacgccgaggcggtcgcggtcgcggaccgggcgggc
tag

DBGET integrated database retrieval system