KEGG   Plantactinospora sp. BB1: C6W10_34995
Entry
C6W10_34995       CDS       T05391                                 

Definition
(GenBank) isoprenyl transferase
  KO
K21273  trans,polycis-polyprenyl diphosphate synthase [EC:2.5.1.88]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00900  Terpenoid backbone biosynthesis
plat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    C6W10_34995
Enzymes [BR:plat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.88  trans,polycis-polyprenyl diphosphate synthase [(2Z,6E)-farnesyl diphosphate specific]
     C6W10_34995
SSDB
Motif
Pfam: Prenyltransf
Other DBs
NCBI-ProteinID: AVT40796
UniProt: A0A2R4FTI3
LinkDB
Position
complement(7976998..7977822)
AA seq 274 aa
MIRAMTNRGRRGPVPPTPHPSGARPPALPVEALPKHVAVVMDGNGRWAKQRGLPRTKGHE
QGEYSLFDTIEGAIELGIPYLSAYAFSTENWRRSPDEVRFLMGFNRDVIRRRRDQLVELG
VRVVWSGRAGRLWKSVISELQTAEEMSRGNSTLTLQFCVNYGGQAEIADAAAAIARDVAA
GRVDPGKVNEKMISRYLYHPEVPPVDMFLRPSGEQRISNFLLWQSAYAELVYLDTLWPDF
DRRHLWYACELYAQRDRRFGGALPNPVAPGPAHG
NT seq 825 nt   +upstreamnt  +downstreamnt
gtgatccgagcgatgaccaaccggggccgtcggggcccggtgccaccgaccccgcacccg
tccggggcccgccccccggcgctgccggtcgaggcgctgccgaagcacgtggcggtggtg
atggacggcaacgggcgctgggccaagcagcgcggactgccccggaccaagggtcacgag
cagggcgagtactccctcttcgacaccatcgagggcgcgatcgaactcggcatcccctat
ctgtcggcgtacgccttctccacggagaactggcggcgctcgccggacgaggtgcgcttc
ctgatgggcttcaaccgggacgtcatccggcgccgccgggaccagttggtggagctgggg
gtccgggtcgtctggtccgggcgggccggccggctctggaagagcgtgatctcggagttg
cagacggccgaggagatgtcccggggcaactcgacgctgaccctccagttctgcgtcaac
tacggcgggcaggccgagatcgccgacgcggccgccgcgatcgcccgggacgtcgccgcc
ggcagggtggatccgggcaaggtcaacgaaaagatgatctcgcggtacctctaccacccc
gaggtgccgccggtcgacatgttcctccgcccctccggcgaacagcggatctccaacttc
ctgctctggcagagcgcgtacgccgaactggtctacctggacaccctctggccggacttc
gaccgccgccacctctggtacgcctgcgagctgtacgcgcagcgggaccgcaggttcggc
ggtgccctgcccaacccggtcgcgcccggaccggcacacggctga

DBGET integrated database retrieval system