KEGG   Plantactinospora sp. BB1: C6W10_35925
Entry
C6W10_35925       CDS       T05391                                 

Definition
(GenBank) erythromycin biosynthesis sensory transduction protein eryC1
  KO
K13310  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase [EC:2.6.1.106]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00523  Polyketide sugar unit biosynthesis
plat01100  Metabolic pathways
plat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    C6W10_35925
Enzymes [BR:plat01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.106  dTDP-3-amino-3,4,6-trideoxy-alpha-D-glucose transaminase
     C6W10_35925
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_1_2 Aminotran_5 Cys_Met_Meta_PP AMP-binding
Other DBs
NCBI-ProteinID: AVT40946
UniProt: A0A2R4FTZ7
LinkDB
Position
8202362..8203462
AA seq 366 aa
MTVPFLDLRAAYAELRAELDAAYARVLASGRYVLGPETEAFEAEFAAFCGAPHCVTVGSG
CDALELALRALGIGDGDEVIVPSHTFIATWLAVSAAGARPVPVEPDERTGTMDPARIEAA
ITGRTRAIMPVHLYGHPADLDGINEVAASRGLAVLEDAAQAHGARYRGRRVGEGSTVAAF
SFYPGKNLGAMGDGGAVLTADAGLAERVRLLRNYGSRVKYQHELRGTNSRLDELQAAFLR
VKLAHLPEWNRRRAEVATRYLTDLAGLPGLTLPGVASWAEPVWHLFVVRTAARDRLRAAL
HRSGVETIIHYPVPPHLAPAYAGLDFPAGGYPVAERLADEVLSLPIGPHLSAEQVETVVA
AVRAGL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgacggtgcccttcctggacctgcgcgccgcgtacgccgaactccgcgccgaactggac
gccgcctacgcccgggtgctggcctccgggcggtacgtgctcgggcccgagacggaggcg
ttcgaggcggagttcgccgccttctgcggcgcaccgcactgcgtcacggtgggcagcgga
tgcgacgcgctggaactggccctgcgggcactcggcatcggcgacggagacgaggtcatc
gtgccgtcgcacaccttcatcgcgacctggttggcggtgtcggcggccggcgcccggccg
gtgccggtcgagccggacgagcggaccgggacgatggacccggcccggatcgaggccgcg
atcaccggtcggaccagggcgatcatgccggtacacctctacggccacccggccgacctg
gacgggatcaacgaggtggccgccagccggggcctggcggtgctggaggacgcggcccag
gcccacggcgcccggtaccgtggccgccgggtcggcgagggttcgaccgtggcggcgttc
agcttctacccgggcaagaacctcggcgcgatgggcgacggcggagcggtgctgactgcc
gacgccgggctggccgagcgggtacggctgctgcgcaactacggctcgcgggtcaagtac
cagcacgagttgcgcggtacgaactcgcggctcgacgaactccaggcggcgttcctgcgg
gtcaaactggcccacctgccggagtggaaccgccgtcgcgccgaggtggcaacgcggtac
ctgacagacctcgccgggctgcccggactgacactgcccggggtggcatcctgggccgaa
ccggtgtggcacctcttcgtggtccggacggcggcccgggaccggctgcgggcggcactg
caccggtccggcgtggagacgatcatccactacccggtgccgccgcacctcgccccggcc
tatgccggcctcgacttcccggccggcggatatccggtcgccgaacgcctcgccgacgag
gtgctcagcctgccgatcggcccgcacctgtcggcggagcaggtcgagacggtggtcgcc
gccgtacgcgccggactgtga

DBGET integrated database retrieval system