KEGG   Paenibacillus lentus: EIM92_00650Help
Entry
EIM92_00650       CDS       T05914                                 

Gene name
thiO
Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
plen  Paenibacillus lentus
Pathway
plen00730  Thiamine metabolism
plen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plen00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    EIM92_00650 (thiO)
Enzymes [BR:plen01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     EIM92_00650 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 NAD_binding_8 FAD_binding_2 HI0933_like Pyr_redox FAD_oxidored Pyr_redox_3 GIDA Thi4 FAD_binding_3 Amino_oxidase ApbA Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AZK48811
UniProt: A0A3Q8SEG1
LinkDB All DBs
Position
complement(115977..117125)
Genome map
AA seq 382 aa AA seqDB search
MNRNVVIMGGGIIGLSCAFELQKRGHRVTLLEIGRCGGQASGAAAGMLAPYSENLVEPDS
FFRLCLDSLQLYPAWQAEVREISGQSFEYSQTGSLYAVYHEADILALEGRLLWQREYGST
GCIVEGEALKQIEPSLSNEIKAALYTPEETHIYAPHFVQALEQACRNLGVNIIEHLESVE
ILDVHQRQWQVSQREIVVRSRDGREFSAERLVVCSGAWARELSEALDFNIPIYPIRGQIC
AYSNIQHTVRGMVFNNQGYVVAKDNGTVICGASEDIAGFDTSVTEKGIDRLRKWNKRLFP
SLEGEIPFHRWAGLRPSTQDGRPLLGALEASDQIVFAAGHYRNGILLSPVTAKIVADVIE
GLELPSYYSAFLPERFNPMIVQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaaatgtagttattatgggaggcgggatcataggcctatcttgtgcttttgaa
ttacaaaagcgtgggcacagagtaactctgctcgagattggccgctgtggcgggcaagct
tcaggagcggctgcgggcatgctggctccatactcggaaaatctggtggaacccgattcc
tttttccgtctatgtctggacagtttgcaactttatccagcatggcaagcggaggttaga
gaaatttcgggacaatcgtttgaatacagccaaaccggcagtctctatgcggtttatcat
gaggccgatatactcgctcttgagggcaggctgctctggcagagagaatacggttctacc
ggttgtattgtggaaggggaagcgctgaagcagattgagccatccctatcaaacgaaata
aaggcggcattatatacgccggaggaaacccatatttacgctccgcattttgtacaggca
ttagagcaggcctgccgcaacttaggcgtaaatattattgagcatttggaaagcgttgag
atccttgatgtacaccaacggcagtggcaagtatcgcagagggagatcgtcgtaaggtca
agggatggtcgggaattttcggcagagcggttagttgtatgctccggtgcctgggctcgt
gaactgtcggaggcgctggatttcaacatcccgatttacccgattcgcggccaaatctgt
gcctatagcaatattcagcatacggtcaggggtatggtatttaataatcaaggttatgtg
gtagccaaagataacggcactgtcatatgcggcgcatctgaggacattgccggattcgat
acttcagtgacggagaaaggcatagatcgcctgcgtaagtggaacaaacggctatttcct
tctctggagggggaaattccttttcataggtgggcgggattgcgtccctccacccaggat
gggcggccattgttaggagcgcttgaagcctctgatcagatcgtctttgccgcaggacat
tatcgtaacggaattttgctcagcccggtgacagccaaaatagttgcggatgtcatcgaa
ggactcgaattgccaagctattattcggcattcctgccggaaagattcaatcctatgatc
gtgcagtaa

DBGET integrated database retrieval system