KEGG   Paenibacillus lentus: EIM92_03400Help
Entry
EIM92_03400       CDS       T05914                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
plen  Paenibacillus lentus
Brite
KEGG Orthology (KO) [BR:plen00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EIM92_03400 (ahpF)
Enzymes [BR:plen01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EIM92_03400 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 DAO HI0933_like FAD_oxidored AlaDh_PNT_C Thi4 NAD_binding_7 NAD_binding_8 FAD_binding_3 K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AZK45367
UniProt: A0A3Q8S3R3
LinkDB All DBs
Position
complement(745983..747512)
Genome map
AA seq 509 aa AA seqDB search
MKLDADIKQQLEQYLQLLEGDVLLKVSAGTDSVSNDMLDLVNELSSMSDRITVEHTQLAR
TPSFSVNRVGEDTGVTFAGVPLGHEFTSLVLALLQVSGRAPKVEQSVIDQIKSIKGEYNF
ETYVSLSCHNCPDVVQALNLMSILNPGITHTMIDGAAFKEEVESKDILAVPTVHLNGEFF
ESGRMTIDDILAKLGTSDASEFENKEPFDVLVIGGGPAGASAAIYAARKGIRTGIVAERF
GGQVNDTLSIENFISVKYTEGPKLAASLEEHAKEYNIDIMKAQRAKRLEKKELIEVELEN
GAVLKSKTVIISTGARWRNLGVPGEVEYKNKGVAYCPHCDGPLFAGKSVAVVGGGNSGIE
AAIDLAGLTEHVTVLEFAPELKADSVLQERLNSLPNTTVIKNAQVKEITGSNRVDGISYV
ERESGETKHVDLEGVFVQIGLVPNTDWLGDTLERTRMGEIVVDNHGATSIPGVFAAGDCT
NSPYKQIIISMGSGATAALGAFDYLIRNQ
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaaactggatgcagacattaaacaacaactggagcaatatcttcagcttctggagggc
gatgttctgctgaaagtcagtgcaggtacggattctgtatctaacgacatgctggattta
gtgaatgaactgtccagcatgtcggacagaatcaccgtagagcatacgcaattggctaga
acgccaagttttagcgtaaatcgtgtgggtgaagacactggcgtaacatttgccggcgtt
ccattgggacatgaattcacctcgctcgtcctggcactgctacaagtcagcggaagagct
ccaaaagttgagcaaagcgtaattgatcagattaagagcattaaaggcgaatataacttc
gagacatacgtaagcctctcctgccataactgtcctgacgttgtgcaggcactcaacctg
atgagtatcctcaatccgggaatcacccatacaatgattgacggagcagcatttaaggaa
gaggtcgagagcaaggatattctggctgtgccaaccgttcatcttaatggtgaattcttc
gagagcggtcgcatgacgatcgatgatattctcgctaaattaggcacttcggatgcatcc
gagttcgagaacaaagagcctttcgatgtattggttatcggtggcggaccagccggtgcg
agtgctgcgatttatgcagctcgtaaagggatccgcacgggtattgttgctgagcgcttt
ggcggtcaagtcaatgatactttgagcattgagaacttcatcagtgtgaagtatacagaa
ggtcctaagcttgctgcaagcctggaagagcatgcgaaggaatacaacattgatattatg
aaggcacagcgtgccaagcgtcttgagaagaaagagcttattgaagttgaactcgagaat
ggcgcggtgttgaaaagtaagacggttattatctccacaggtgcccgttggcgtaatctc
ggcgtacctggtgaagttgaatataaaaacaaaggtgtggcttactgtccgcactgtgac
ggccctctatttgctggaaagagcgttgcagtggtcggcggcggcaactccggtattgaa
gcagcaattgacctggcaggtctaactgaacatgtgactgttctggaattcgcgccggaa
ctgaaggctgactccgtactgcaagagcgcctaaacagcttgcctaacacaacagttatc
aaaaatgcgcaagtgaaagaaatcacgggctctaaccgtgtggacggcattagttacgtc
gagcgcgagagcggcgagacgaagcatgttgatctggaaggcgtattcgttcaaatcggt
ttggttccaaatacggattggcttggtgatacgcttgaacgtacccgcatgggcgaaatt
gtcgtagacaatcatggcgcaaccagcattcctggtgtatttgctgcaggagactgcacg
aactcaccttacaagcaaatcatcatttcgatgggctccggtgcaaccgcagcgttaggt
gcattcgattacctgattcgaaatcaataa

DBGET integrated database retrieval system