KEGG   Paenibacillus lentus: EIM92_06575Help
Entry
EIM92_06575       CDS       T05914                                 

Definition
(GenBank) flagellar protein FlgN
Organism
plen  Paenibacillus lentus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FlgN NYD-SP28_assoc
Motif
Other DBs
NCBI-ProteinID: AZK45907
UniProt: A0A3S8RT41
LinkDB All DBs
Position
1469002..1469502
Genome map
AA seq 166 aa AA seqDB search
MSVYQIISTLKKLNEVHVQLLEIGKEKQQAIIKNDSFVLTTLMTKENRLLKKMDDIEVQR
GEAVTSFLSEKGIRSQLNLTVSEISRLVFDPDEKRELLEIRDLLVDNTMQLKKQNEHTKE
LLEQSLHFIDFSLNLIFGVDEDMIYRKPTDQQPTLTNRNNYFDTKA
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtttatcaaattatttcaactttaaagaaattgaatgaagttcatgtccaattg
ttagagatcggcaaagaaaagcaacaggcaattattaaaaatgattctttcgttttaact
acgcttatgacaaaagaaaatcgtttgttgaagaaaatggacgatatcgaggtacaaagg
ggtgaagctgtaacctcctttttaagtgagaaggggatccgttcgcagttgaatttgact
gtttcagaaatttctcggcttgtctttgacccagatgaaaaaagagaattgttagaaatt
cgtgatttattagtagataacactatgcagttaaaaaaacaaaatgaacatacaaaggaa
ttattagaacaatccttacattttattgatttctccttgaatttaatatttggcgtagat
gaagatatgatttatagaaaaccaacagatcaacagccaacattaacaaatagaaataat
tattttgacacaaaagcataa

DBGET integrated database retrieval system