KEGG   Paenibacillus lentus: EIM92_10540Help
Entry
EIM92_10540       CDS       T05914                                 

Gene name
yajC
Definition
(GenBank) preprotein translocase subunit YajC
  KO
K03210  preprotein translocase subunit YajC
Organism
plen  Paenibacillus lentus
Pathway
plen02024  Quorum sensing
plen03060  Protein export
plen03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plen00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    EIM92_10540 (yajC)
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EIM92_10540 (yajC)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EIM92_10540 (yajC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plen02044]
    EIM92_10540 (yajC)
Secretion system [BR:plen02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   EIM92_10540 (yajC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YajC PDZ Orf78 TssO
Motif
Other DBs
NCBI-ProteinID: AZK46534
UniProt: A0A3S8RUK7
LinkDB All DBs
Position
2338671..2338991
Genome map
AA seq 106 aa AA seqDB search
MFHFAATAAPAAGNPLITLVVPFAIMFIVFYFLLIRPQKKKQQSRNQMLRALQKGDKIVT
IGGLHGTIVSLTDDTVVLLVNDATKLTFERNAISHSVSAAASSESK
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgttccactttgcagcaacagcagctccggctgcggggaatccgcttattactttggtt
gttcccttcgcgatcatgtttatcgtgttctattttctgttgattcgaccgcagaagaag
aagcagcaatctcgcaaccaaatgctgagagcgctccagaaaggggacaaaatcgtcacg
attggcggtttgcacggtacgatcgtatcactaacggatgataccgtcgtgcttctcgtg
aatgatgcgaccaagcttacgtttgaacgtaacgcaattagccatagcgtgagtgcggct
gcttcttccgaatcgaaataa

DBGET integrated database retrieval system