KEGG   Paenibacillus lentus: EIM92_10545Help
Entry
EIM92_10545       CDS       T05914                                 

Definition
(GenBank) TIGR04086 family membrane protein
Organism
plen  Paenibacillus lentus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3792
Motif
Other DBs
NCBI-ProteinID: AZK46535
UniProt: A0A3Q8SAY8
LinkDB All DBs
Position
complement(2339062..2339457)
Genome map
AA seq 131 aa AA seqDB search
MDFFRRLASIRLSHPTLSGIWYAFLWMMVGALVLSLLLQSGSLEEHKLTWPIYTVHAAAL
LFGGFTSGKRAGQKGWYQGSLTGLFYGILILVISLLALDNSPGLSDLTLLLPAVLIGALG
GMFGVNLHRKK
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggatttcttccggcgtttggcatcaattcggctttctcaccctactctttccggcatt
tggtacgctttcttatggatgatggtcggggctctcgtcttgtcccttctgcttcaatca
ggctcactggaggaacataagctaacatggcctatttataccgttcatgcggcggctctg
ttatttggaggatttacttcggggaaacgtgcgggacaaaaaggatggtaccaaggctct
cttaccggattattctatggaattctaattttagtcatcagcctgctcgcattagacaac
tctccgggactaagcgatttaactttactccttcctgccgtattaattggtgcactcggt
ggcatgttcggggttaatttgcacaggaaaaagtaa

DBGET integrated database retrieval system